DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp99a

DIOPT Version :8

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster

Alignment Length:127 Identity:28/128 (22%)
Similarity:52/128 (41%) Gaps:13/128 (10%)


  Fly     7 ICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCL 71
            ||:|    :.:.|...:.:..:  |.||..:....|....:|.....:......|.:.:|:|.|:
  Fly     7 ICVL----IGLASADYVVKNRH--DMLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCV 65

  Fly    72 AEKGNLLDTNGYLDVDKIDQIEPV------SDELREILYDCKKIYDEEEDHCEYAFKMVTCL 127
            ..|..|.|.....:|:.|.| :.|      ::.....|..|....::..:.||:|::..|||
  Fly    66 FTKWGLFDVQSGFNVENIHQ-QLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCL 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 24/107 (22%)
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.