DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp51a

DIOPT Version :8

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster

Alignment Length:134 Identity:35/135 (26%)
Similarity:58/135 (43%) Gaps:23/135 (17%)


  Fly     2 LKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYKC 66
            :|:::..:|.::|.::.|.....|.|   :|.....|:...|:..  .:||          |.||
  Fly     1 MKVFIGLVLLLAVTTLSSALFESEAN---ECAKKLGITPDYFENF--PHSS----------RVKC 50

  Fly    67 FIHCLAEKGNLLDTNGYL---DVDKIDQIEPVS-DELREILYDCKKIYDEEEDHCEYAFKMVTCL 127
            |.||..||..:: .||.:   |: |:..|.|.| |:....:..|.|:  ...|.||..:.:..||
  Fly    51 FYHCQMEKLEII-ANGVVTPFDL-KVLNISPESYDKYGVKVKPCLKL--SHRDKCELGYLVFQCL 111

  Fly   128 TESF 131
            ...|
  Fly   112 KREF 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 28/107 (26%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.