DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp83g

DIOPT Version :8

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster

Alignment Length:132 Identity:30/133 (23%)
Similarity:52/133 (39%) Gaps:22/133 (17%)


  Fly    17 IQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLEN-----------------TDRRY 64
            :||.|||.....|:..|.:...::...::..|...:.|:..|:                 ..||.
  Fly     1 MQSQSLLLIVAAVATFLVAQTTAKFLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFPAHRRT 65

  Fly    65 KCFIHCLAEKGNLL-DTNGYLDVDKIDQI-EPVSDELREILYDCKKIYDE---EEDHCEYAFKMV 124
            .||:.|..||..|. :..|:.:...|.|. ...|.:|..:.:..:|..|.   |.|.|.:|.::.
  Fly    66 SCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAESDVCTWANRVF 130

  Fly   125 TC 126
            :|
  Fly   131 SC 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 25/122 (20%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.