DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and Nphs1

DIOPT Version :8

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_072150.1 Gene:Nphs1 / 64563 RGDID:620460 Length:1252 Species:Rattus norvegicus

Alignment Length:883 Identity:177/884 (20%)
Similarity:289/884 (33%) Gaps:313/884 (35%)


  Fly    15 LLVLSALNGPAAAASRVRVSSSTTMTRNIEEENALLLLLAGPPV-----LSESIM--GTVGRLPC 72
            |||....| ||....   :.:|.||.         :|...||||     |:|..:  |....|||
  Rat   228 LLVCEGSN-PALDTP---IKASFTMN---------ILFPPGPPVIDWPGLNEGHVRAGENLELPC 279

  Fly    73 NV---TPPIYEDRVALVIWYKVGLKTPIYSVDTRDSNFAQGTHWSDETYRERLSFHVEGRAGTLT 134
            ..   .||      |.:.|.|.|  .|:            .|.|..|        |.:..|.::.
  Rat   280 TARGGNPP------ATLQWLKNG--KPV------------STAWGTE--------HAQAVAHSVL 316

  Fly   135 IKSTTEDDTGEYRCRVDFQ-----KSPTRNSKVNLTVIIPPESVIIL------DSKGVTI----- 183
            :.:...:|.|   .|:..|     .:.|:...:.|.|..||.::.||      ::|.||:     
  Rat   317 VMTVRPEDHG---ARLSCQSYNSVSAGTQERSITLQVTFPPSAITILGSVSQSENKNVTLCCLTK 378

  Fly   184 --------------------------------------------EDHTL---------------- 188
                                                        ||:.|                
  Rat   379 SSRPRVLLRWWLGGRQLLPTDETVMDGLHGGHISMSNLTFLVRREDNGLPLTCEAFSDAFSKETF 443

  Fly   189 ------------------GP-----YNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNASVGQPL 230
                              ||     ...|:.:.:.|:||||.|.|.:.|...:.......  ||.
  Rat   444 KKSLTLNVKYPAQKLWIEGPPEGQYIRTGTRVRLVCLAIGGNPDPSLIWFKDSRPVSEPR--QPQ 506

  Fly   231 SERRV--------GNTLSLARLERRNL---------HMQLTCRAENNNLTTPIISSVVLDMNLRP 278
            ..|||        |:|.|      |.|         ..:.:|:|...:.:|.::      :...|
  Rat   507 EPRRVQLGSVEKSGSTFS------RELVLIIGPPDNRAKFSCKAGQLSASTQLV------VQFPP 559

  Fly   279 LIVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKGSTPMKNTHEIATPD-----GNLTTSVL 338
            ..:.:...:.||..|::..|:||.|.:.|...::|.|....:::.  .|.|.     |:..:..:
  Rat   560 TNLTILANSSALRPGDALNLTCVSISSNPPVNLSWDKEGERLEDV--AAKPQSAPFKGSAASRSV 622

  Fly   339 TFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVFFECN 403
            ....:..|.|:.::|||....:.|: :...::.::.:.|..   ||......|:.|...|....:
  Rat   623 FLRVSSRDHGQRVTCRAHSEALRET-VSSFYRFNVLYPPEF---LGEQVRAVTVVEQGQVLLPVS 683

  Fly   404 IKSNPWIYEVSWRHNGKILTNNPAEG---IAVSNQSLVLQNASRARSGIYTCVGSNREGDGESNP 465
            :.:||.....:|...|..|  :||.|   ..:|..:|.|.|.:||..|.|.....|.||..|: .
  Rat   684 VSANPAPEAFNWTFRGYRL--SPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNSEGTAEA-L 745

  Fly   466 VQLDIRFAPVCRP-RQRLSYSSGRHETVKVACEIDANP-AEATYVWKFNATQGETVDIP------ 522
            ::||:.:||..|. |.....:.|  .:|.:.|.:|||| ....:.|:....:.|.:::.      
  Rat   746 LKLDVHYAPTIRALRDPTEVNVG--GSVDIVCTVDANPILPEMFSWERLGEEEEDLNLDDMEKVS 808

  Fly   523 ------------------ASQVAVDRG---------RSIAHY-------TPMTE----------- 542
                              |.|..||.|         |.:..:       ||:|:           
  Rat   809 KGSTGRLRIRQAKLSQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDQPTPLTKVAAAGDSTSSA 873

  Fly   543 -----------------------------------------------------NDYGTLLCWATN 554
                                                                 .||....|.|||
  Rat   874 TLHCRARGVPNIDFTWTKNGVPLDLQDPRYTEHRYHQGVVHSSLLTIANVSAAQDYALFKCTATN 938

  Fly   555 EIGDQSEPCVYTIFPAGEPDPLLNCTVLNQTSTGFQIECIEGFNGGLQQDFIM--EVYMNGTTRH 617
            .:|  |:.....:.....|||.|...|::.:.....:|...||:|||.|.|.:  |........|
  Rat   939 ALG--SDHTNIQLVSISRPDPPLGLKVVSISPHSVGLEWKPGFDGGLPQRFQIRYEALETPGFLH 1001

  Fly   618 PKISKSKRPYFEVSGLVPGMGYNVFLIANNSKGRSNAT 655
            ..:..::...|.::||.|...|.::|:|:|:.|.|..|
  Rat  1002 VDVLPTQATTFTLTGLKPSTRYRIWLLASNALGDSGLT 1039

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 28/126 (22%)
IG_like 60..166 CDD:214653 23/116 (20%)
Ig 182..266 CDD:299845 28/189 (15%)
Ig 296..373 CDD:299845 16/82 (20%)
IG_like 389..464 CDD:214653 23/78 (29%)
IGc2 394..459 CDD:197706 20/68 (29%)
Ig_3 490..554 CDD:290638 22/169 (13%)
Nphs1NP_072150.1 Ig 52..128 CDD:299845
IG_like 52..127 CDD:214653
C2-set_2 155..242 CDD:285423 6/18 (33%)
Ig_3 256..335 CDD:290638 25/110 (23%)
IG_like 268..350 CDD:214653 22/113 (19%)
C2-set_2 358..440 CDD:285423 8/82 (10%)
I-set 460..555 CDD:254352 24/109 (22%)
Ig 472..555 CDD:299845 22/97 (23%)
Ig 563..646 CDD:299845 18/85 (21%)
IG_like 670..750 CDD:214653 25/83 (30%)
Ig 676..750 CDD:299845 23/77 (30%)
Ig_3 753..834 CDD:290638 17/83 (20%)
IG_like 762..848 CDD:214653 15/88 (17%)
Ig 848..956 CDD:299845 12/110 (11%)
IG_like 859..949 CDD:214653 10/92 (11%)
FN3 955..1049 CDD:238020 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.