DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and hbs

DIOPT Version :8

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster

Alignment Length:888 Identity:187/889 (21%)
Similarity:298/889 (34%) Gaps:282/889 (32%)


  Fly    18 LSALNGPAAAASRVRVSSSTTMTRNIEEENALLLLLAGPP---------VLSESIMGTVGRLPCN 73
            ||.|..|.|.... ..|...|:.|..|.:.|.......||         |...|...|.|||..|
  Fly   243 LSVLYPPGAPFFE-GYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNGVAISSPQRTSGRLSEN 306

  Fly    74 V-----------------------TPPIYEDRVALVIWY-------------KVGLKTPIYSVDT 102
            |                       |.|:..: :.|.:.|             |||....:..| |
  Fly   307 VYKFTAAAEDNGANLVCEAKNLLATTPLRAE-LNLTVLYAPKDVYLSGANQAKVGDSVQLSCV-T 369

  Fly   103 RDSNFAQGTHWSDETYRERLSFHVEGR-AGTLTIKSTTEDDTGEYRCRVDFQKSPTRNSKVNLTV 166
            ..||           .:.|:|:.:.|| ....|.|:|:..|.|.           ..:|.::||:
  Fly   370 APSN-----------PQARISWSINGRPLDNSTYKTTSSSDGGW-----------VSSSNISLTI 412

  Fly   167 IIPPESVIILDSKGVT----------------IEDHT-----------LGPYNEG----SG--IN 198
                      ||:..|                :..||           |..||:|    ||  :.
  Fly   413 ----------DSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILK 467

  Fly   199 ITCVAIGGRPQPRVTWLHGNTVYKNASV---GQPLSERRVGNTLSLARLERRNLHMQLTCRAENN 260
            :.|.:.||.|.|.:.|      |||..:   ...|.:.::.:.|||. :...:.:....|:.:|.
  Fly   468 LQCSSAGGNPPPTLQW------YKNDKIINAPSKLVDSKITSELSLL-VNASDNNAIYKCKVQNA 525

  Fly   261 NLTTPIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKGSTPMKNTHE 325
            .:..|:.::..|.::..|..||:....:.|..|...:|.|....:.|...|:|||...|::..:.
  Fly   526 AIDIPLFATKTLGVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNL 590

  Fly   326 IATP---DGNLTTSVLTFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNS 387
            ...|   .|:::|..:....|.|..|...:|::...::..| :.:...|||.:.|.......|..
  Fly   591 ANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRS-VHETISLDILYPPKFETPQSTTF 654

  Fly   388 LNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNPAEGIAVSNQSLV-------LQNASRA 445
            :..   ||.....|.....||.:...:|..:|..:::|     ::|.|.|:       :...||.
  Fly   655 VGV---EGAPFHVELLASGNPMVITYTWTKDGLPISSN-----SLSGQRLISDGPRLNISRLSRN 711

  Fly   446 RSGIYTCVGSNREGDGESNPVQLDIRFAPVCRPRQRLSYSSGRH----ETVKVACEIDANPAEAT 506
            .:|:|.|...|.:|..... :|:.:.:||..     .:.|.||.    |...:||.|.|.|.||.
  Fly   712 DAGVYICEALNSQGTALLE-IQVAVEYAPTI-----TAVSEGRSFVAGEPAVLACHIQARPLEAA 770

  Fly   507 YV-WKFN----ATQG----------------ETVDI-------------PASQ---------VAV 528
            :| |..:    ||:.                |..||             ||:|         ..:
  Fly   771 HVRWSRDGYDLATRTISSFENGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEI 835

  Fly   529 DRG------------------RSIAHYTP-----------------------------------M 540
            |..                  ||:|...|                                   :
  Fly   836 DHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALL 900

  Fly   541 TEN----DYGTLLCWATNEIGDQSEPCVYTIFPAGEPDPLLNCTVLNQTSTGFQIECIEGFNGGL 601
            .||    |||...|...|.:|..|....::  ....||..|...|.|.:.||..:....||:||:
  Fly   901 IENTSPDDYGQYECVVRNSLGQASTTLEFS--KPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGGM 963

  Fly   602 QQDFIMEVYMNGTTRHPKI-SKSKRPYFEVSGLVPGMGYNVFLIANNSKGRSNATILQVYTLKDP 665
            |..|.:.:..:|..::..: :|.......:.||.||..|...::|.|..|.|...         |
  Fly   964 QTYFRLRLKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFM---------P 1019

  Fly   666 EKQTVKITFTKSFQGLRPAYTKTKATATTTSDCVCDEDEFLNL 708
            :   :|:|.:|..|.....||              ::||..|:
  Fly  1020 D---IKLTLSKGSQPHSAEYT--------------EKDELPNV 1045

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 33/157 (21%)
IG_like 60..166 CDD:214653 30/143 (21%)
Ig 182..266 CDD:299845 25/120 (21%)
Ig 296..373 CDD:299845 18/80 (23%)
IG_like 389..464 CDD:214653 18/82 (22%)
IGc2 394..459 CDD:197706 17/72 (24%)
Ig_3 490..554 CDD:290638 29/164 (18%)
hbsNP_001286439.1 Ig 44..122 CDD:299845
IG_like 45..137 CDD:214653
Ig 153..231 CDD:299845
IG_like 258..342 CDD:214653 18/85 (21%)
Ig 266..327 CDD:299845 12/61 (20%)
IG_like 357..>414 CDD:214653 20/90 (22%)
Ig 360..427 CDD:299845 20/100 (20%)
Ig <468..526 CDD:299845 15/65 (23%)
I-set 547..633 CDD:254352 19/87 (22%)
Ig 556..631 CDD:299845 16/75 (21%)
I-set 644..735 CDD:254352 21/100 (21%)
IGc2 668..725 CDD:197706 14/62 (23%)
IG_like 751..829 CDD:214653 18/78 (23%)
IGc2 753..815 CDD:197706 15/62 (24%)
Ig 852..928 CDD:143165 13/76 (17%)
FN3 935..1017 CDD:238020 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.