DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and side

DIOPT Version :8

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster

Alignment Length:1006 Identity:261/1007 (26%)
Similarity:408/1007 (41%) Gaps:227/1007 (23%)


  Fly     8 SLFLPLCLLVLSALNGPAAAASRVRVSSSTTMTRNIEEENALLLLLAGPPVLSESIMGTVGRLPC 72
            :|.|..||..|.:::..         ..|....:||            |..|..:.:|....|||
  Fly    69 TLVLLTCLQQLKSVSAD---------EESQDFQKNI------------PARLVWAALGKTVELPC 112

  Fly    73 NVTPPIYEDRVALVIWYKVGLKTPIYSVDTRDSNFAQGTH---WSDETYRERLSFHV--EGRAGT 132
            ::|||..:|.|.|::|:|.....|:||:|:|..|.....|   .||  ..:||.|.:  ..:...
  Fly   113 DLTPPTSQDSVKLLLWFKDTTGIPLYSLDSRGGNVKLAPHAAIASD--LGQRLFFSIGDNPKDSR 175

  Fly   133 LTIKSTTEDDTGEYRCRVDFQKSPTRNSKVNLTVIIPPESVIILDSKGVTIEDHTLGPYNEGSGI 197
            |.|.....:|.|.|||||||..|||||.:.|||:::|||...|.|::|..| ....||:.||..:
  Fly   176 LQINDVKPEDGGVYRCRVDFFNSPTRNFRHNLTLVVPPEEPRIFDAQGKEI-SQMAGPFREGYEL 239

  Fly   198 NITCVAIGGRPQPRVTWLHGNT---------VYKNASVGQPLSERRVGNTLSLARLERRNLHMQL 253
            .:.|...||||.|:|||...:|         |.:.|:|        :.|.|.:....|....:::
  Fly   240 FLCCQVRGGRPPPKVTWWRDDTELIGTSHTSVEEGATV--------MVNQLLIGTTTRDFYGIRI 296

  Fly   254 TCRAENNNLTTPIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKGST 318
            .|||:...|..|:...|.:.:.|:|:.||:...|..|:||....:.|...|:.||..|||.....
  Fly   297 ECRAQGTRLVDPVRKDVTVQVYLKPVRVKIATPNELLTAGQPMPIRCESWGSYPAAKITWLLDGE 361

  Fly   319 PMKNTHEIAT----PDGNLTTSVLTFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVV 379
            |::|. |:..    .|||:|||:||...|.::....|:|||.........:||...:.:.:.|.|
  Fly   362 PIRNA-EVTVHSDKEDGNITTSILTLKVTSENDNAELTCRATNPWFSGGAIEDKRIIRVAYPPTV 425

  Fly   380 SLELGTN--SLNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNPAEGIAVSNQSLVLQNA 442
            |:.|...  |...|..||.:|.|:|...:.|.:...||..||..::..       |.:.:.|...
  Fly   426 SVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRMSGE-------STEIMHLTQL 483

  Fly   443 SRARSGIYTCVGSNREGDGESNPVQLDIRFAPVCRPRQRLSYSSGRHET---------VKVACEI 498
            .|..:|.|.|..:|.||:..|:.:.|.::|:|.|:        ||..:|         :.|.||:
  Fly   484 ERESAGAYACGATNTEGETRSSSLTLKVQFSPRCK--------SGTEQTSIGAVSLHSILVKCEV 540

  Fly   499 DANPAEAT-YVWKFNATQGETVDIPASQVAVDRGRSIAHYTPMTENDYGTLLCWATNEIGDQSEP 562
            ||:|.::. :.|.:|.|:..: .:..|::..:...|...|.|.|:::..||.|||:|.:|.|:.|
  Fly   541 DADPPDSVRFSWTYNNTRNVS-PVLNSRIQSNGLASTVTYLPQTDSELITLACWASNAVGRQTTP 604

  Fly   563 CVYTIFPAGEPDPLLNCTVLNQTSTGFQIECIEGFNGGLQQDFIMEVY----------------- 610
            |:..|.||..|:....|.:.|.|.  .::.|:.|.:|||.|.|::||.                 
  Fly   605 CLVHILPANTPEAPKACELRNDTV--LEVVCVAGSDGGLSQYFMLEVVGGDPLYSGDPGGSAGQG 667

  Fly   611 -----------------MNGTTRHPKISKSKR--PYFEVSGLVPGMGYNVFLIANNSKGRSNATI 656
                             :|.......|.:.:.  |.|.::.|.||..|...:.|.|:||||...:
  Fly   668 RGQFSEAIGLGDNEISTLNDQATSAPIFRMQENSPQFRLNNLEPGREYQFLVYAVNAKGRSEPPV 732

  Fly   657 ----LQVYTLKDPEKQTVKITFTKSFQGLRPAYTKTKATATTT---SDCVCDEDEFLNLGKGISH 714
                ::|.....|..:::              .::....|.||   ...|........||.|.| 
  Fly   733 VIENVRVAAQLGPYDESI--------------LSEDPTPAETTHHGGGGVGGSGSSSGLGTGAS- 782

  Fly   715 DEGTDADQQEDLSLAYAPVIEDIRPFLGILAGIVGSIFLVALIIVIVVR--------VRGSSGRD 771
             .|:..::|..|.:..|.|:        |.|.:|.||.:..:::|...|        ||.|....
  Fly   783 -TGSGPEKQSTLLILAAVVV--------IGAVVVTSIIVAGIVVVCRHRPRPPEPQEVRKSMRPA 838

  Fly   772 RN------------NYSHPGSGVGGVGGVGGTTGNGSGMGGGG----GGVGGTTANGNGSLGLLA 820
            ||            |....|.|............|....||||    ||||              
  Fly   839 RNDVPSMYIEEDELNELEEGGGRAADIRARVAPPNSHLCGGGGMPMPGGVG-------------- 889

  Fly   821 SNNNGSLVIGTLG-HN--------------GGQSVQDMHRIGRETCHVTSSLDSI---------- 860
              ::|..::|..| |:              .|..:..:.....:.|...|::.|:          
  Fly   890 --SSGGAIVGVAGPHHYISESFIQYAQPSLNGDVLLPLLVTSSQPCSTNSTISSVVLAMPQAKLC 952

  Fly   861 ----DKN-------PDIIPQDGHDLDDEWTT 880
                .:|       ||:|...|   :.|:||
  Fly   953 PDPASRNTAWPPEYPDLILPRG---ELEFTT 980

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 45/116 (39%)
IG_like 60..166 CDD:214653 43/111 (39%)
Ig 182..266 CDD:299845 26/93 (28%)
Ig 296..373 CDD:299845 25/81 (31%)
IG_like 389..464 CDD:214653 21/75 (28%)
IGc2 394..459 CDD:197706 18/65 (28%)
Ig_3 490..554 CDD:290638 20/74 (27%)
sideNP_001247334.1 V-set 95..211 CDD:284989 46/130 (35%)
IG_like 100..211 CDD:214653 43/113 (38%)
Ig 235..301 CDD:299845 21/74 (28%)
Ig 326..408 CDD:299845 27/83 (33%)
IG_like 329..407 CDD:214653 27/79 (34%)
IG_like 435..511 CDD:214653 23/83 (28%)
Ig_2 442..511 CDD:290606 21/76 (28%)
FN3 <700..735 CDD:238020 12/35 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130793281
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.