DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: side-VIII and side-VII

Sequence 1:NP_001097382.2 Gene:side-VIII FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster

Alignment Length:1078 Identity:334/1079 (31%)
Similarity:495/1079 (46%) Gaps:215/1079 (20%)


  Fly    61 ESIMGTVGRLPCNVTPPIYE-DRVALVIWYKVGLKTPIYSVDTRDSNFAQGTHWSDET-YRERLS 123
            |||:|....||||||  .|: |...||:||:....|||||:|.|.........|||:: :.:|..
  Fly    29 ESIVGENIYLPCNVT--TYDGDEPVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAY 91

  Fly   124 FHVEGRAGTLTIKSTTEDDTGEYRCRVDFQKSPTRNSKVNLTVIIPPESVIILDSKGVTIEDHTL 188
            |..:...|.|:|::|...|:|.|||||||.|:.|.||::.|.||.||:.|||.||..|. ....:
  Fly    92 FIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVE-RSTVV 155

  Fly   189 GPYNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNA-SVGQPLSERRVGN----TLSLARLERRN 248
            |||:||..:::.|..|||.|.|.::|      |::. .:...||....|.    .::|..|.|.:
  Fly   156 GPYSEGDIVSLKCQVIGGYPTPTISW------YRDGIEIPCELSHLAGGKIIECEITLPSLGRED 214

  Fly   249 LHMQLTCRAENNNLTTPIISSVV-LDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARPAPTIT 312
            |:.:|||||.::. ..||:.:|| :|||..||.::|.|.::.||||..|.|.|...|:||...||
  Fly   215 LNSRLTCRALSHP-RAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVIT 278

  Fly   313 WWKGSTPMKNTHEIATPDGNLTTSVLTFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIP 377
            ||:....::.|.|..:.|||.|||.|:.:.:..|.||:|||:|....:|...:||||||||.::|
  Fly   279 WWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVP 343

  Fly   378 VVSLELGTNSLNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNPAEGIAVSNQSLVLQNA 442
            ...:.|||:...||||||.||:|:|.:.::|.::.:.||||.:.|::|.:.|:.:||.|||||..
  Fly   344 EAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSLVLQGV 408

  Fly   443 SRARSGIYTCVGSNREGDGESNPVQLDIRFAPVCRPRQRLSYSSGRHETVKVACEIDANPAEATY 507
            :||.:|.|:|||.|.||:|.|.|..|:|.:||.|...|:..|...:.|..||.|.:||||.|..:
  Fly   409 TRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEF 473

  Fly   508 VWKFNATQGETVDIPASQVAVDRGRSIAHYTPMTENDYGTLLCWATNEIGDQSEPCVYTIFPAGE 572
            .|.|| ...|::|:..:.:......||..|||:||.|||||||.|:|:||.|..|||:.|..||.
  Fly   474 SWTFN-NSAESIDVATNHIIRSGTTSIVTYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGR 537

  Fly   573 PDPLLNCTVLNQTSTGFQIECIEGFNGGLQQDFIMEVYMNGTTRHPKIS-KSKRPYFEVSGLVPG 636
            |:.:.||||.|.:.|...:.|.:||||||.|.|.:|: ::..|:..|.: .|..|.|.|.||.||
  Fly   538 PEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLEL-LDSYTQEIKANITSTIPKFTVPGLSPG 601

  Fly   637 MGYNVFLIANNSKGRSNATILQVYTLKDPEKQTVKITFTKSFQGLRPAYTKTKATATTTSDCVCD 701
            ..|.:.:.|.|:||||:..|:....|:.||||..                               
  Fly   602 SIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLT------------------------------- 635

  Fly   702 EDEFLNLGKGISHDEGTDADQQEDL--SLAYAPVIEDIRPFLGILAGIVGSIFLVALIIVIVVRV 764
                              ::|..:|  .|.::||       :.:..|:..::.:..|.|::.:|:
  Fly   636 ------------------SEQTHNLRAELLFSPV-------MSLTIGLTLAVLVAVLAIILALRI 675

  Fly   765 --RGSSGRDRNNYSHPGSGVGGVGGVGGTTGNGSGMGGGGGGVGGTTANGNGSLGLLASNNNGSL 827
              ..||.|.:...|                                  |.|.|.......::.| 
  Fly   676 PCTASSRRRQKELS----------------------------------NENISRDESPGPSDKS- 705

  Fly   828 VIGTLGHNGGQSVQDMHRIGRETCHVTSSLDSIDKNPDIIPQDGHDLDDEWTTKGHGRTYATAAM 892
                   :|.:.|.|        |.        :||||::|:.....:...:.:...:.......
  Fly   706 -------SGSKEVDD--------CD--------EKNPDVVPESIEPDEQAESIRKRQQISTIDTN 747

  Fly   893 AEQNAVITSGTYDHLMPTYAVVDKKTAPPPGHGQYIQYNTLIPVSKMGAYANQQQQLQQQPQQKT 957
            ...|..|......||  |.|.:..:.:    ||  |.|.||    :.|.:|..|..:.:.....|
  Fly   748 RSPNRGIFVNEQQHL--TAAEISLRAS----HG--IGYCTL----RSGMHAQAQSSVGEISINVT 800

  Fly   958 ELSYSELSAPLVSGPVGVQRMAPYCSATLGRPGRQAELKRAEPNIYSQVNVMMDDEILADLQAAT 1022
            ...||.                .....||.|...|        |:::..|.    .|......:|
  Fly   801 PHVYSN----------------SISQCTLPRQSSQ--------NVWNNYNC----NITGARPTST 837

  Fly  1023 ASGRSYVAGAVVDNVGGAPNLYVQGYATRIDLAHHP-MPM--YSTSPMFGTNSTITGVTMSHPSQ 1084
            ....::..|.|  ||||                |:| .|:  ::.||...:||::...|.:    
  Fly   838 FHQLTFPQGRV--NVGG----------------HNPAQPLHGHAPSPSQASNSSMASSTNT---- 880

  Fly  1085 LATFSPTPPP---PIFTHSMVTTGDGLLQPVTCMGLVA 1119
                .|.|.|   .|..|.|.....|.:    |:|:.:
  Fly   881 ----LPQPHPHGRTIAMHHMNQAQCGRV----CIGIAS 910

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 46/107 (43%)
IG_like 60..166 CDD:214653 46/107 (43%)
Ig 182..266 CDD:299845 26/89 (29%)
Ig 296..373 CDD:299845 34/77 (44%)
IG_like 389..464 CDD:214653 37/75 (49%)
IGc2 394..459 CDD:197706 30/65 (46%)
Ig_3 490..554 CDD:290638 29/64 (45%)
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 43/104 (41%)
V-set 32..134 CDD:284989 43/104 (41%)
IGc2 160..>214 CDD:197706 16/60 (27%)
Ig 262..328 CDD:299845 27/66 (41%)
IG_like 264..323 CDD:214653 25/59 (42%)
IGc2 360..425 CDD:197706 30/65 (46%)
Ig_3 456..519 CDD:290638 29/64 (45%)
FN3 538..620 CDD:238020 34/83 (41%)
FAM176 643..741 CDD:291517 24/163 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130792963
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23278
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.