DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and syg-2

DIOPT Version :8

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_001309674.1 Gene:syg-2 / 181561 WormBaseID:WBGene00007750 Length:1230 Species:Caenorhabditis elegans

Alignment Length:1224 Identity:224/1225 (18%)
Similarity:372/1225 (30%) Gaps:496/1225 (40%)


  Fly    31 VRVSSSTTMTRNIEEENALLLLLAGPPVLSESIMGTVGRLPCNVT----PPIYEDRVALVIWYKV 91
            :|::::||:.......:..:.:|..|..|......|:.   |:||    ||.       |.||..
 Worm   218 IRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIA---CSVTGGNPPPD-------VFWYHE 272

  Fly    92 GLKTPIYS-VDTRDSNFAQGTHWSDETYRERLSFHVEGRAGTLTIKSTTEDDTGEYRCRVDFQKS 155
            ..:...:| :|||....           :...||           .::..|:..||.||.:  .|
 Worm   273 NKRLQSHSTLDTRSKEI-----------KNIYSF-----------IASQNDNMAEYECRAN--NS 313

  Fly   156 PTRNSK---VNLTVIIPPESV-------------------------------------------- 173
            .|.|.|   :.|.|..||.||                                            
 Worm   314 RTGNPKRKAMKLEVNYPPASVELFGESNIRYGSSANIQCKSLPSNPASQITWIINGRSVPTPTQR 378

  Fly   174 -------------IILDSKGVTIEDHTLG-----------------------------------P 190
                         :.:.|..:::|.|.:.                                   .
 Worm   379 EFVVENGIVSSSNVSVHSNELSVEAHQINVECMATNPEGSSAKQHVIKIIAPPKAPIITGLEDRK 443

  Fly   191 YNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNASVGQPLSERRVGN-------------TLSLA 242
            :.||..:|:||.|.||.|...::|..|:.  |:...|:...:....|             ||:| 
 Worm   444 FFEGDIVNVTCEAQGGNPLAELSWYRGSE--KHLVKGRKKMKWSQVNGAHNEVAGFSSYSTLAL- 505

  Fly   243 RLERRNLHMQLTCRAENNNLTTPIISSVVLDMNLRPLIVKLQ----GENRALSAGNSYQLSCVVI 303
            |::|.....:|.|.|.|..|..|:|.|..|.:...|..|.::    |:.|.| .|.|.:|.|..:
 Worm   506 RVDRTMNTQRLKCEATNAALDEPLIESQYLSVYYPPRRVLIRPADSGDQRLL-VGKSARLVCGTL 569

  Fly   304 GARPAPTITW-WKGSTPMKNTH-------EIATPDGNLTTSVLTFTPTIDDRGKFLSCRAEQSMI 360
            .:.||..|:| :..:|.....|       |....:|....:||:||||.:..|..:.|.|..   
 Worm   570 SSNPAAHISWQFSRATDDNKVHLGDVSLNETTRDNGFNVENVLSFTPTEEYDGTVVHCIANH--- 631

  Fly   361 PESGMEDGWK--------LDIYHIPVVSLELGTNSLNSTLREGIDVFFE-CNIKSNPWIYEVSWR 416
            ||      ||        |::.:.|.:   |..:.:...:.|| |.|.| ..::.||.|....||
 Worm   632 PE------WKHSVNTSFPLNVMYPPKM---LVNDPVTVVMSEG-DSFKENLTVRGNPAISLWQWR 686

  Fly   417 HNGKILTNNP----AEGIAVSNQSLVLQNASRARSGIYTCVGSNREGDGESN---PVQLDIRFAP 474
            .||....:..    |.|..:|.:.|:..:|     |:||...:|..|.....   .|:...|...
 Worm   687 KNGVPFDHTIGRVFARGAVLSGKQLLSTDA-----GVYTLTATNSVGSTNITIKLAVEYSARITS 746

  Fly   475 VCRPRQRLSYSSGRHETVKVACEIDANPAEATYV-W-------------------KFNATQGET- 518
            :..|   :..::|  :||.:.||.|..|::|..: |                   :.|||:.:: 
 Worm   747 ISTP---VIAATG--DTVLLECEADGEPSKANMIHWYKNGEILAAQHRGHKKAILRLNATEQQSG 806

  Fly   519 ---------VDIPAS--------------QVA-----------VDRGRSIAHYTPM--------- 540
                     :.:||.              .||           |.:.|...:..|.         
 Worm   807 EYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKDE 871

  Fly   541 --------------TENDYGTL--LCWATNEIGD---QSEPCV-----------YTIFPAGEPDP 575
                          |:.||.|.  ..|..|.:.|   :...|:           ..|.|...||.
 Worm   872 QLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDE 936

  Fly   576 LLNCTVLNQTSTGFQIECIEGFNGGLQQDFIME--------VYMNGTTRHPKISKSKRPYFEVSG 632
            ..|.|:.|.|.....:.....|:||..|.|.::        :::..|| |..:        .:||
 Worm   937 PFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTT-HTNL--------RLSG 992

  Fly   633 LVPGMGYNVFLIANNSKGRSNATILQVYTLKDPEKQTVKITFTKSFQGLRPAYTKTKATATTTSD 697
            |.....|...:.:.|::|.:::....|            |..|.:..|:..|..:.:....||  
 Worm   993 LATANTYFFQIRSINARGFASSWTSPV------------IFATLNEDGVNVAMIRNEKLKLTT-- 1043

  Fly   698 CVCDEDEFLNLGKGISHDEGTDADQQEDLSLAYAPVIEDIRPFLGILAGIVGSIFLVALIIVIVV 762
                                            :.|.|               .||:|..:::.||
 Worm  1044 --------------------------------WIPYI---------------LIFIVLFMLLNVV 1061

  Fly   763 -------RVRGSSGRDRNNYSHPGSGVGGVGGVGGTTGNGSGMGGGGGGVGGTTANGNGSLGLLA 820
                   |.:....|::...:......|.|..|                                
 Worm  1062 ICCFVCNRTKKRKLREKTEMARTAINGGDVRQV-------------------------------- 1094

  Fly   821 SNNNGSLVIGTLGHNGGQSVQDMHRIGRETCHVTSSLDSIDKNPDIIPQDGHD------------ 873
                  .:.||:..|.|.|.:|                 ||..|: :.:|.|.            
 Worm  1095 ------QMYGTMMGNDGMSRRD-----------------IDDRPE-MSEDEHSVRTMIEVSPNGY 1135

  Fly   874 --------------LDDEWTTKGH-GRTYATAAMAEQNAVITSGTYDHLMPTYAVVDKKTAPPPG 923
                          |:.::.|:.: |.:..|.:|                 |||.|.....|.|.
 Worm  1136 MQPIEPMLYESTGLLEYDYQTRSYMGSSQGTRSM-----------------TYANVPYPEPPQPS 1183

  Fly   924 HGQYIQYNTL--------IPVSKMGAYANQQQQLQQQPQQKTELSYSELSAPLV 969
            :  :..:|:|        .|...:..:.|....::..|     ::|::|...||
 Worm  1184 Y--HSNWNSLQRQSNNNTSPQHHLSTFINPNMGVRAGP-----INYAQLDGDLV 1230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 27/119 (23%)
IG_like 60..166 CDD:214653 25/114 (22%)
Ig 182..266 CDD:299845 27/132 (20%)
Ig 296..373 CDD:299845 24/93 (26%)
IG_like 389..464 CDD:214653 22/80 (28%)
IGc2 394..459 CDD:197706 21/70 (30%)
Ig_3 490..554 CDD:290638 23/144 (16%)
syg-2NP_001309674.1 IG_like 25..105 CDD:214653
Ig 33..122 CDD:299845
Ig 147..228 CDD:299845 3/10 (30%)
IGc2 248..313 CDD:197706 20/99 (20%)
Ig 450..537 CDD:299845 26/90 (29%)
Ig 559..632 CDD:299845 21/76 (28%)
I-set 657..738 CDD:254352 22/87 (25%)
Ig 665..738 CDD:299845 21/79 (27%)
IG_like 748..828 CDD:214653 15/85 (18%)
IGc2 756..817 CDD:197706 12/63 (19%)
Ig 845..922 CDD:299845 11/77 (14%)
FN3 934..1023 CDD:238020 22/110 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.