DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and si:ch211-180a12.2

DIOPT Version :8

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:XP_001920945.3 Gene:si:ch211-180a12.2 / 100150385 ZFINID:ZDB-GENE-121214-236 Length:903 Species:Danio rerio

Alignment Length:343 Identity:81/344 (24%)
Similarity:122/344 (35%) Gaps:86/344 (25%)


  Fly   150 VDFQKSPTRNSKVNLTVIIPPESVIILDSKGVTIEDHTLGPYNEGSGINITCVAIGGRPQPRVTW 214
            ||...||..::.:|.:..:|            .:.|::|        :||             ||
Zfish    21 VDVSVSPGSSTVLNCSFALP------------ALVDNSL--------LNI-------------TW 52

  Fly   215 LHGNTVY--KN--------ASVGQPLSERRVGNTLSLARLERRNLHMQ--LTCRAENNNLTTPII 267
            ..|.::.  ||        .|...|.....|.|...         |.|  ..||...|:  |...
Zfish    53 SSGGSIIASKNHTQAGFFLNSTAFPSFPLTVFNATP---------HQQGVYECRVSYND--TDYA 106

  Fly   268 SSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGAR----PAPTITWWKGSTPMKNTHEI-- 326
            :.|.|.: |.|.:|.:......|.     :.|.|...||    |....||.:|...::...::  
Zfish   107 TEVTLTI-LAPPVVSIISPEAVLK-----RKSVVECWARSFSPPQIMFTWTRGGNKIQEPQKLQV 165

  Fly   327 -ATPDGNL-TTSVLTFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNSLN 389
             .|.||.. ..|.|||.|.|.::.....|..:.|.:.:..:|: :...|..:|.|:|.:..:|.:
Zfish   166 NRTEDGLYDAVSFLTFIPQISNQNISFGCEVQHSALVKPVLEE-FTPHITVLPKVTLSVVPSSSH 229

  Fly   390 S---TLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNP-----AEGIAVSNQSLVLQNASRAR 446
            |   ||...|..|:..||       .|.|.||||.|:..|     .:|....:|...|....|:|
Zfish   230 SSSVTLSCDISGFYPNNI-------SVLWIHNGKKLSELPLSIQNEDGTYRRHQYHTLTREERSR 287

  Fly   447 SGIYTCVGSNREGDGESN 464
            .|...||.....|...:|
Zfish   288 GGEVQCVALQPSGQEPAN 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 5/16 (31%)
IG_like 60..166 CDD:214653 5/16 (31%)
Ig 182..266 CDD:299845 19/96 (20%)
Ig 296..373 CDD:299845 20/85 (24%)
IG_like 389..464 CDD:214653 24/83 (29%)
IGc2 394..459 CDD:197706 20/70 (29%)
Ig_3 490..554 CDD:290638
si:ch211-180a12.2XP_001920945.3 Ig 19..114 CDD:299845 27/138 (20%)
IG_like 22..113 CDD:214653 26/135 (19%)
C1-set 123..205 CDD:284964 20/87 (23%)
IgC 237..309 CDD:143166 22/77 (29%)
IgC 515..604 CDD:143166
IgC 609..720 CDD:143166
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.