DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and kin-10

DIOPT Version :8

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_492254.1 Gene:kin-10 / 172610 WormBaseID:WBGene00002196 Length:235 Species:Caenorhabditis elegans

Alignment Length:226 Identity:126/227 (56%)
Similarity:158/227 (70%) Gaps:16/227 (7%)


  Fly     1 MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDP 65
            |:.|:|.|||.|||..||||||||||||||||:|||..|:..|..|:.||::||||.|....||.
 Worm     1 MSSSEEVSWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPEDDIEDN 65

  Fly    66 AEPE--LEASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128
            |...  :|.:||.||||||||:|||||||..|::|:...:||.|||.:|.:||:|||||||.|||
 Worm    66 ATNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPGE 130

  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPT 193
            .||::|||:||||::|::|||.:.||::||||||||.|...||.||:|...:|||:||||||||.
 Worm   131 AMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLYGFKIHPV 195

  Fly   194 AY------------RTAAEIQKDVTMTPVGE 212
            ||            ...|..|.:.  ||.|:
 Worm   196 AYGGQEGNSGGNTANNVAAAQNNT--TPAGQ 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 111/182 (61%)
kin-10NP_492254.1 CK_II_beta 8..191 CDD:198153 112/183 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1335521at2759
OrthoFinder 1 1.000 FOG0000423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126846
Panther 1 1.100 O PTHR11740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.