DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CSNK2B

DIOPT Version :8

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001311.3 Gene:CSNK2B / 1460 HGNCID:2460 Length:215 Species:Homo sapiens

Alignment Length:198 Identity:130/199 (65%)
Similarity:156/199 (78%) Gaps:2/199 (1%)


  Fly     1 MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASED- 64
            |:.|:|.|||.|||..|||||||||||:||||||||..|:..|.:|:.||::||||.|....|| 
Human     1 MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDN 65

  Fly    65 PAEPEL-EASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128
            |.:.:| |.:||.||||||||:|||||||..||:||.:|:||.|||.:|.:||:|||||||.|||
Human    66 PNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGE 130

  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPT 193
            .||::|||||.|||.||:|||.:.|||:||||||||.||..|:.||||...:||||||||||||.
Human   131 AMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPM 195

  Fly   194 AYR 196
            ||:
Human   196 AYQ 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 120/182 (66%)
CSNK2BNP_001311.3 CK_II_beta 8..191 CDD:198153 121/183 (66%)
Interaction with alpha subunit. {ECO:0000250} 188..193 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1335521at2759
OrthoFinder 1 1.000 FOG0000423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126846
Panther 1 1.100 O PTHR11740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.