DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Cpr72Ec

DIOPT Version :8

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster

Alignment Length:66 Identity:21/66 - (31%)
Similarity:31/66 - (46%) Gaps:10/66 - (15%)


  Fly   113 NGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQN 177
            :||.::|     .|:..:.|..:|..:..  ....|||| .:.|.|..:..||:.|.|.|||  |
  Fly    27 SGYQEQD-----TARAFYSYGYRDENAAR--AEYSSRDG-TSRGFYSYVDADGKLQTVRYEA--N 81

  Fly   178 G 178
            |
  Fly    82 G 82

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 17/51 (33%)
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.