DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and CG34205

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster

Alignment Length:108 Identity:31/108 - (28%)
Similarity:42/108 - (38%) Gaps:29/108 - (26%)


  Fly     4 FTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGGA 68
            |:|:.        :||.|.|  ..|..|..:..||:    |..:.|.:|:.:|.        ..|
  Fly   132 FSSVV--------SHATPIV--KSYAAPAIAYAAPA----PVIKSYAAPAISYA--------HAA 174

  Fly    69 PSNSYGAP-----IAPPQGQYGAPALTGAIFKGGNGNGNGGYG 106
            |:.||.||     .|.|...|.||||..:.  .......||||
  Fly   175 PAISYAAPTVVKSYAAPAISYAAPALVKSY--AAPALSLGGYG 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791
CG34205NP_001097407.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.