DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and CG11585

DIOPT Version :8

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster

Alignment Length:148 Identity:40/148 - (27%)
Similarity:61/148 - (41%) Gaps:25/148 - (16%)


  Fly    14 AAWTHAEPPV--PQNQYLPP---NQSPQAPSNNYLPPTQGYQSPS-SNYLPPQRAGGNGGAPSN- 71
            |:.|....||  |..|||.|   :.|..|.|:...|....|.:|: |:|..|..:.|:..:.|: 
  Fly   203 ASHTSYSAPVAAPSRQYLAPAASSYSAPAVSSYSAPAVSSYSAPAVSSYSAPAVSHGSSYSTSSL 267

  Fly    72 ---SYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGPAKYEFKYD 133
               ||.||....: .|.|||::...:.|.:.....|||.|:.:|:|........:|         
  Fly   268 SHGSYAAPSVSSK-TYAAPAVSHGSYSGSSSGSGHGYGSGSSHGSGVRSGHGSSFG--------- 322

  Fly   134 VQDYESGNDFGHMESRDG 151
                 ||:..|...:..|
  Fly   323 -----SGHKSGSYAANGG 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 4/24 (17%)
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000727
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.