DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and aralar1

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster

Alignment Length:348 Identity:81/349 (23%)
Similarity:139/349 (40%) Gaps:62/349 (18%)


  Fly    32 PTSTAVVTPTLKDVAPRQLTRN--HNIAAAAVAE--GDSCEF----GSNHYFLLCGLGGIISCGS 88
            |.|:.:....|.::||...|::  |.:|.....|  .|...|    .|::.|.|....|.:..  
  Fly   307 PPSSRIDYSDLSNIAPEHYTKHMTHRLAEIKAVESPADRSAFIQVLESSYRFTLGSFAGAVGA-- 369

  Fly    89 THTMVVPLDLVKCRLQ-------VDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLC 146
              |:|.|:||||.|:|       :....|::.:..|:..:..||..||.:|..|..:|.:.:...
  Fly   370 --TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 432

  Fly   147 KFGLYEVFKKVYGDAIGEENAFLYRTGLYLA---ASASAEFFADIALAPMEAAKVKIQTTPGFAK 208
            |..:.::.:    |.:.::...:......||   |.||...|.:    |:|..|:::|.....|.
  Fly   433 KLTVNDLVR----DKLTDKKGNIPTWAEVLAGGCAGASQVVFTN----PLEIVKIRLQVAGEIAS 489

  Fly   209 TLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQL 273
            ..:.....:..:.|:...|||.....:|.:|::.:.|..:..|..::         ||.......
  Fly   490 GSKIRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMM---------ADKDGYNHP 545

  Fly   274 VVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLV-------PRIVM 331
            :...|||.||||..|.:..|||.:.::| |....|.     |..::|:|....       ||...
  Fly   546 LTLLAAGAIAGVPAASLVTPADVIKTRL-QVVARSG-----QTTYTGVWDATKKIMAEEGPRAFW 604

  Fly   332 IGTLTAAQWFIYDAVKVFLRMPR 354
            .||          |.:||...|:
  Fly   605 KGT----------AARVFRSSPQ 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 23/96 (24%)
Mito_carr <188..258 CDD:278578 13/70 (19%)
Mito_carr 273..350 CDD:278578 24/84 (29%)
aralar1NP_001247368.1 EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 24/106 (23%)
PTZ00169 358..631 CDD:240302 69/298 (23%)
Mito_carr 449..539 CDD:278578 21/103 (20%)
Mito_carr 544..633 CDD:278578 25/91 (27%)
EF-hand_7 35..99 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2021280
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.