DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and GC2

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:303 Identity:79/303 - (26%)
Similarity:123/303 - (40%) Gaps:65/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GLGGII--SCGSTHTMVVPLDLVKCRLQ---VDP---AKYKSVFTGFRISLAEEGVRGLAKGWAP 135
            |:.|||  :|      |.|||:||.|||   :.|   ..|.|:...||.::|.||..|:.:|.|.
  Fly    28 GVAGIIGVAC------VYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAV 86

  Fly   136 TFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKI 200
            ..:..:.:...|....:.|:  |..|..:....|.|..|   |...|..|..:...|||..|:::
  Fly    87 NIVLITPEKAIKLTANDFFR--YHLASDDGVIPLSRATL---AGGLAGLFQIVVTTPMELLKIQM 146

  Fly   201 Q-------------------TTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFA 246
            |                   |..|..|||       ..:.|:...|||:....:|.|.::|:.|.
  Fly   147 QDAGRVAAADRAAGREVKTITALGLTKTL-------LRERGIFGLYKGVGATGVRDITFSMVYFP 204

  Fly   247 CFERTLELLYKYVVPK-PRADCTKGEQLVV-TFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASA 309
                    |..::..: ||.....||.:.. :..||.::|:..|.:..|.|.|.::| ||.|...
  Fly   205 --------LMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRL-QADGEKK 260

  Fly   310 LD--------VAKQLGWSGLWGGLVPRIVMIGTLTA-AQWFIY 343
            ..        ..|:.|.|..:.|.:.||:::..|.. ||.|.:
  Fly   261 FKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 28/88 (32%)
Mito_carr <188..258 CDD:278578 19/88 (22%)
Mito_carr 273..350 CDD:278578 21/81 (26%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 74/287 (26%)
Mito_carr 16..106 CDD:278578 26/83 (31%)
Mito_carr 123..203 CDD:278578 21/89 (24%)
Mito_carr 228..302 CDD:278578 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.