DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Mpcp2

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster

Alignment Length:370 Identity:265/371 (71%)
Similarity:296/371 (80%) Gaps:19/371 (5%)


  Fly     1 MFKSLFDAAQNSTFKSPFTSVNCQSATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVA--- 62
            ||.|.|:.|:||.|::|.:...|.:|.|        ||.|        |......|||||..   
  Fly     1 MFSSFFETARNSPFRTPMSMARCDAAAP--------VVEP--------QPVEGRQIAAAATPVAN 49

  Fly    63 EGDSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVR 127
            :.|||||||..||.|||:|||:|||:|||.||||||||||||||.||||::..||::::||||.|
  Fly    50 QQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGAR 114

  Fly   128 GLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAP 192
            ||||||.||.:|||.||||||||||:||..|.:.||||||:||||.|||||||||||||||||||
  Fly   115 GLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAP 179

  Fly   193 MEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYK 257
            .|||||||||.||:|...|||:|||..:|||.|||||||||||||||||||||||||||:|||||
  Fly   180 FEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYK 244

  Fly   258 YVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLW 322
            ||||||||||||||||:||||||||||||||:||||||.|||||||||||||:.|||.||:||:|
  Fly   245 YVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKSLGFSGMW 309

  Fly   323 GGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKK 367
            .||.|||:|||||||.||||||.|||.|.:|||||||||.|||.|
  Fly   310 NGLTPRIIMIGTLTALQWFIYDGVKVALGIPRPPPPEMPASLKAK 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 64/89 (72%)
Mito_carr <188..258 CDD:278578 58/70 (83%)
Mito_carr 273..350 CDD:278578 63/77 (82%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 62/84 (74%)
Mito_carr <175..245 CDD:278578 58/70 (83%)
Mito_carr 260..338 CDD:278578 64/78 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C269184229
eggNOG 1 0.900 E1_KOG0767
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 362 1.000 Inparanoid score I567
Isobase 1 0.950 0.834419 Normalized mean entropy S396
OrthoDB 1 1.010 D423866at33208
OrthoFinder 1 1.000 FOG0001724
orthoMCL 1 0.900 OOG5_127220
Panther 1 1.100 P PTHR45671
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2231
98.870

Return to query results.
Submit another query.