DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG18324

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster

Alignment Length:313 Identity:67/314 (21%)
Similarity:124/314 (39%) Gaps:64/314 (20%)


  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQ-----------VDPAKYKSVFTGFRISLAEEGVRGLAKGW 133
            |||..:.|:. ....|:|:||.|:|           |.|  |:.:.......:..:|:..|.||.
  Fly     8 LGGTAAMGAV-VFTNPIDVVKTRMQLQGELAARGTYVKP--YRHLPQAMLQIVLNDGLLALEKGL 69

  Fly   134 APTFIGYSMQGLC-KFGLYEVFKKVYGDAI------GEENAFLYRTGLYLAA--SASAEFFAD-- 187
            ||        .|| :|.|..|...||.:|:      ..:.:..:..|::..|  ..:..:||.  
  Fly    70 AP--------ALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPF 126

  Fly   188 IALAPMEAAKVKIQTTPGFA---KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFE 249
            ..:...:.|:.......||.   .::.:||..:....|::.|::..:|...|.:..:.::...|.
  Fly   127 YMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFP 191

  Fly   250 RTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-NQ---AKGASAL 310
            :...||      |.:...|  ..::::|.||..:|...|:.:.|.|.:.::: ||   .||...:
  Fly   192 KAKSLL------KDKGWIT--HPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLM 248

  Fly   311 ---------DVAKQLGWSGLWGGLVP---RIVMIGTLTAAQWFIYDAVKVFLR 351
                     .:.:..|..|::.|..|   |.....|||    |::....:.||
  Fly   249 YKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLT----FVFFEKLLHLR 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 26/92 (28%)
Mito_carr <188..258 CDD:278578 12/73 (16%)
Mito_carr 273..350 CDD:278578 20/93 (22%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 25/90 (28%)
PTZ00169 5..293 CDD:240302 65/308 (21%)
Mito_carr 101..201 CDD:278578 17/106 (16%)
Mito_carr 204..296 CDD:278578 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2026716
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.