DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG18327

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster

Alignment Length:288 Identity:68/289 (24%)
Similarity:115/289 (40%) Gaps:61/289 (21%)


  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQVD---------PAKYKSVFTGFRISLAEEGVRGLAKGWAP 135
            |||:.:.|: .....|::::|.|:|:.         ...|||||..|......:|:.||.||.||
  Fly     8 LGGVAAMGA-GVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71

  Fly   136 TFIGYSMQGLC-KFGLYEVFKKVYGDAI---------GE----ENAFLYRTGLYLAASASAEFFA 186
                    .|| :|.:......:|..|:         ||    :..|....|..:.:..::.||.
  Fly    72 --------ALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFL 128

  Fly   187 DIALAPMEAAKVKIQTTPGFA---KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACF 248
            .......:|||   |...|:.   .::.:|:.|:..:.||...::|.:....|....:.::.|.|
  Fly   129 IKTQLQAQAAK---QIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVF 190

  Fly   249 ERTLELLYKY-VVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-NQAKGAS--- 308
            .:...||.:. ||..|         .:::|.:|..||.|.::...|.|.|.::| ||...|.   
  Fly   191 GQAKSLLKENGVVTHP---------TILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRG 246

  Fly   309 ---------ALDVAKQLGWSGLWGGLVP 327
                     .|.:.:..|..||:.|..|
  Fly   247 IYYRGWLDCVLTILRSEGVYGLYKGFWP 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 25/90 (28%)
Mito_carr <188..258 CDD:278578 15/73 (21%)
Mito_carr 273..350 CDD:278578 18/69 (26%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/88 (27%)
PTZ00169 5..293 CDD:240302 68/289 (24%)
Mito_carr 101..201 CDD:278578 21/103 (20%)
Mito_carr 204..296 CDD:278578 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2026798
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.