DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG9582

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster

Alignment Length:302 Identity:73/303 (24%)
Similarity:118/303 (39%) Gaps:47/303 (16%)


  Fly    75 FLLCGLGGIISCGSTHTMVVPLDLVKCRLQVD---PAKYKSVFTGFRISLAE----EGVRGLAKG 132
            ||..||.|.|.....|    |||:||.|:|:.   |...:.|:|....::.:    ||:..|.||
  Fly    17 FLAGGLSGFIEIICFH----PLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKG 77

  Fly   133 WAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASAS-AEFFADIALAPMEAA 196
            ..|.....:.:...||.:||..|..:.....:.      |.|..|.|.| |.......:.|.|..
  Fly    78 IVPPICVETPKRGGKFLMYESLKPYFQFGAPQP------TPLTHAMSGSMAAILESFLVNPFEVV 136

  Fly   197 KVKIQTTPG-FAKTLREALPKMTAQE---GVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYK 257
            |:..|...| ..|||  ::.|...:.   |:...|:|:..|..|...:....|..:.     ..|
  Fly   137 KITQQAHRGKRLKTL--SVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYN-----ALK 194

  Fly   258 YVVPKPRADCTKG--EQLVVTFAAGYIAGVFCAIVSHPADTVVSKL---NQAKG--------ASA 309
            .:||.|. |.|..  .::::   ||..:.:.| ::|...|....::   ...||        ::.
  Fly   195 DIVPSPE-DKTYNILRKVII---AGLASSLAC-VMSVTLDMAKCRIQGPQPVKGEVKYQWTISTI 254

  Fly   310 LDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLR 351
            ....|:.|:..|:.||...|:.:|...|.....|:.:..||:
  Fly   255 KSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLK 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 28/92 (30%)
Mito_carr <188..258 CDD:278578 16/74 (22%)
Mito_carr 273..350 CDD:278578 17/88 (19%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 73/301 (24%)
Mito_carr 17..104 CDD:278578 28/91 (31%)
Mito_carr 109..196 CDD:278578 22/100 (22%)
Mito_carr 216..295 CDD:278578 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1992688
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.