DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and MME1

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster

Alignment Length:296 Identity:70/297 (24%)
Similarity:113/297 (38%) Gaps:54/297 (18%)


  Fly    75 FLLCGLGGIISCGSTHTMVVPLDLVKCRLQV-------DPAKYKSVFTGFRISLAEEGVRGLAKG 132
            |:..|:||:.:....|    |||.:|.|||.       .|.:||.|......:...||.||..:|
  Fly    18 FIAGGVGGMCNVLVGH----PLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRG 78

  Fly   133 WAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYL--------AASASAEFFADIA 189
            .:...:|.:......|.:|...|:            |::|..::        ||.|.|...:.:.
  Fly    79 ISAPLVGVTPIYAVDFAVYAAGKR------------LFQTD
DHIRLTYPQIFAAGALAGVCSALV 131

  Fly   190 LAPMEAAKVKIQTT-----PGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFE 249
            ..|.:..||.:||.     |.......:...|:..|.|:.:.:||.....:|..| |...|..:|
  Fly   132 TVPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYE 195

  Fly   250 RTLELLYKYVVPKPRADCTKGE-QLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGAS----A 309
            ...||        .|.....|: ....|..:|..||:....::.|.|.:.|:|..|...:    .
  Fly   196 FLQEL--------ARKKS
ANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGI 252

  Fly   310 LDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWF 341
            ..|.:.|    |...|:.|::|.::.....|||.:|
  Fly   253 RSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFF 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 25/92 (27%)
Mito_carr <188..258 CDD:278578 18/75 (24%)
Mito_carr 273..350 CDD:278578 19/78 (24%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/105 (26%)
Mito_carr 111..205 CDD:278578 23/103 (22%)
Mito_carr 208..297 CDD:278578 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1985110
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.