DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:305 Identity:71/305 - (23%)
Similarity:120/305 - (39%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQV---------DPAKYKSVFTGFRISLAEEGVRGLAKGWAP 135
            |....|..|...:..|.|:.|.|:|:         ..|||:.:.......:.|||:..|..|.:.
  Fly    41 LTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISA 105

  Fly   136 TFIGYSMQGLCKFGLYEVF--KKVYGDAIGE-ENAFLYR--TGLYLAASASAEFFADIALAPMEA 195
            ....:|:....|...|:..  |.:..|..|. :.:||..  :|:...|:||      :...|.|.
  Fly   106 MLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATAS------VLTNPTEL 164

  Fly   196 AKVKIQT--------TPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTL 252
            .|:::|.        .|.....:.:||..:....||...:||.||...|....|:...:|::...
  Fly   165 IKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCK 229

  Fly   253 ELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL------NQAKG---AS 308
            ..|.        |:....:...|.|.|...|||..||:|.|||.|.|::      .|.:|   ..
  Fly   230 RFLI--------AEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKG 286

  Fly   309 ALDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVF 349
            :||...:|    |:..::.|.:|..:.:|..:...|..::.::.|
  Fly   287 SLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 20/90 (22%)
Mito_carr <188..258 CDD:278578 17/77 (22%)
Mito_carr 273..350 CDD:278578 25/90 (28%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 66/278 (24%)
Mito_carr 32..129 CDD:278578 20/87 (23%)
Mito_carr 138..233 CDD:278578 22/100 (22%)
Mito_carr 246..331 CDD:278578 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.