DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:199 Identity:49/199 - (24%)
Similarity:85/199 - (42%) Gaps:32/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LCGLGGIISCGS-THTMVVPLDLVKCRLQV--------DPAKYKSVFTGFRISLAEEGVRGLAKG 132
            |||    ::.|: ...:..|.||||.::|:        :|.:..|....||..:...|::||.||
  Fly   149 LCG----VTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKG 209

  Fly   133 WAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAK 197
            ..|.....::..|.....|:..|.:..:.:...:...    :::.||..|.|.|.|...|.:..|
  Fly   210 SIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHT----VHVLASVCAGFVAAIMGTPADVVK 270

  Fly   198 VKIQTTP-----------GFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERT 251
            .:|...|           |....||:.:.|    ||..|.|||.:|.|:|..|:::..:..||:.
  Fly   271 TRIMNQPTDENGRGLLYRGSVDCLRQTVSK----EGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331

  Fly   252 LELL 255
            .:::
  Fly   332 RKMI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 23/91 (25%)
Mito_carr <188..258 CDD:278578 21/79 (27%)
Mito_carr 273..350 CDD:278578
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 49/197 (25%)
Mito_carr 39..138 CDD:278578
Mito_carr 142..239 CDD:278578 23/93 (25%)
Mito_carr 248..336 CDD:278578 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.