DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and C14C10.1

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_506148.1 Gene:C14C10.1 / 182608 WormBaseID:WBGene00007584 Length:334 Species:Caenorhabditis elegans

Alignment Length:357 Identity:189/358 (53%)
Similarity:247/358 (69%) Gaps:34/358 (9%)


  Fly    16 SPFTSVN----CQSATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEGDSCEFGSNHYFL 76
            :||:.|.    |.|  |.|..:::..:.|                            |||..:::
 Worm     2 NPFSDVMRKALCSS--PQSPSSNSTGLVP----------------------------FGSPKFYV 36

  Fly    77 LCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYS 141
            |||:||.|.||.||.::.|||:||||:||||.||..|..||::::||:||||||:.||||.||||
 Worm    37 LCGMGGSICCGFTHLVITPLDIVKCRMQVDPLKYTGVVQGFKVAVAEDGVRGLARAWAPTTIGYS 101

  Fly   142 MQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGF 206
            .||..|||.||:||.|||..:.||||:.||:.:||||::|||||||..|||.||.||::||:...
 Worm   102 AQGFGKFGYYEIFKNVYGSMLSEENAYTYRSWVYLAAASSAEFFADFFLAPFEAVKVRMQTSSTA 166

  Fly   207 AKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGE 271
            .||:||.:|.:..:||:..|:|||.|||.||||||.:||.||||.:||:|.:|||||||:|||.|
 Worm   167 PKTMRECMPMIYKKEGMYGFFKGLPPLWTRQIPYTTVKFVCFERIMELMYTHVVPKPRAECTKME 231

  Fly   272 QLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLVPRIVMIGTLT 336
            ||:|||:|||:||:.||:.|||.|.:||:|||...|:....||:||..|:|.||..||:||||:|
 Worm   232 QLLVTFSAGYLAGILCAVASHPPDVIVSQLNQDPNATLTSTAKKLGLKGMWAGLGARIIMIGTIT 296

  Fly   337 AAQWFIYDAVKVFLRMPRPPPPEMPESLKKKL 368
            |.||||||..||.:.:|||||.|||:|::|||
 Worm   297 AMQWFIYDGWKVVMGIPRPPPAEMPDSIRKKL 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 55/89 (62%)
Mito_carr <188..258 CDD:278578 38/70 (54%)
Mito_carr 273..350 CDD:278578 45/77 (58%)
C14C10.1NP_506148.1 Mito_carr 31..122 CDD:278578 55/91 (60%)
Mito_carr <148..218 CDD:278578 38/70 (54%)
Mito_carr 233..304 CDD:278578 42/71 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0767
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37649
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.834419 Normalized mean entropy S396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D423866at33208
OrthoFinder 1 1.000 FOG0001724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45671
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.