DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and F01G4.6

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001076673.1 Gene:F01G4.6 / 178020 WormBaseID:WBGene00008505 Length:387 Species:Caenorhabditis elegans

Alignment Length:310 Identity:220/311 (71%)
Similarity:252/311 (81%) Gaps:0/311 (0%)


  Fly    59 AAVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAE 123
            |:..|....||||..|:..|.|||::|||.|||.:|||||||||:||:|.||..:.||||.::||
 Worm    74 ASSYEAGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAE 138

  Fly   124 EGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADI 188
            ||.|.|.||||||.:|||.|||.|||.||:||.||.|.:|||||:||||.|||||||||||||||
 Worm   139 EGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADI 203

  Fly   189 ALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLE 253
            .||||||.||:|||:||...|||...|.:...||:|.|||||.||||||||||||||||||:|:|
 Worm   204 LLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVE 268

  Fly   254 LLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGW 318
            .||:||||||||:|:|.|||||||.|||||||||||||||||||||||||...|:|..:.|:||:
 Worm   269 ALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGF 333

  Fly   319 SGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKL 368
            :|:|.||||||:|||||||.||||||:|||.|.:|||||||||.|||.||
 Worm   334 AGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 57/89 (64%)
Mito_carr <188..258 CDD:278578 48/70 (69%)
Mito_carr 273..350 CDD:278578 59/77 (77%)
F01G4.6NP_001076673.1 Mito_carr 86..177 CDD:278578 58/91 (64%)
PTZ00169 95..365 CDD:240302 197/270 (73%)
Mito_carr <203..273 CDD:278578 48/70 (69%)
Mito_carr 288..365 CDD:278578 59/77 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H37649
Inparanoid 1 1.050 468 1.000 Inparanoid score I839
Isobase 1 0.950 0.834419 Normalized mean entropy S396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D423866at33208
OrthoFinder 1 1.000 FOG0001724
OrthoInspector 1 1.000 T97992
orthoMCL 1 0.900 OOG5_127220
Panther 1 1.100 O PTHR45671
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2231
TreeFam 00.000 Not matched by this tool.
1110.950

Return to query results.
Submit another query.