DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and T05F1.8

DIOPT Version :8

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_492561.2 Gene:T05F1.8 / 172809 WormBaseID:WBGene00011493 Length:393 Species:Caenorhabditis elegans

Alignment Length:372 Identity:221/373 (59%)
Similarity:271/373 (73%) Gaps:28/373 (8%)


  Fly     1 MFKSLFDAAQNSTFKSPFTSVNCQSATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEGD 65
            :|..:|||||.:....|..|...::|..:||.||.|         ||                  
 Worm     3 LFHDVFDAAQKNGLVIPSASSVVRTAKCSSAATSVA---------AP------------------ 40

  Fly    66 SCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLA 130
             .||||:.::.:|.|||.:|||.||..:.|||:||||:||:..||.|:..||::::||:||||||
 Worm    41 -IEFGSSQFYAMCALGGSLSCGLTHFAITPLDIVKCRIQVNKEKYGSMVQGFKVTIAEDGVRGLA 104

  Fly   131 KGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEA 195
            :||||||||||.|||.|||.|||||.:|..::|||||:::||.:||||||||||||||.||||||
 Worm   105 RGWAPTFIGYSAQGLGKFGFYEVFKNIYSLSLGEENAYIWRTSIYLAASASAEFFADIFLAPMEA 169

  Fly   196 AKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVV 260
            .||::||:|....|||...|.:..|||:|.|:|||.|||.||||||||||.|||:|:||||:|||
 Worm   170 VKVRMQTSPTAPTTLRACAPMIYKQEGLTGFFKGLPPLWTRQIPYTMMKFTCFEKTVELLYQYVV 234

  Fly   261 PKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGL 325
            |||||.|:|.|||.|||.||||||||||:||||.|.:||||||...||...:.||||:.||||||
 Worm   235 PKPRAQCSKSEQLAVTFTAGYIAGVFCAVVSHPPDVLVSKLNQDSNASVGSLVKQLGFKGLWGGL 299

  Fly   326 VPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKLGVTG 372
            .|||:|:|||||.||||||:.||.:.:||||||:||||||||||:.|
 Worm   300 GPRIIMVGTLTALQWFIYDSFKVAMNLPRPPPPQMPESLKKKLGIPG 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 54/89 (61%)
Mito_carr <188..258 CDD:278578 45/70 (64%)
Mito_carr 273..350 CDD:278578 54/77 (70%)
T05F1.8NP_492561.2 Mito_carr 52..132 CDD:278578 52/80 (65%)
Mito_carr <162..232 CDD:278578 45/70 (64%)
Mito_carr 247..321 CDD:278578 52/74 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0767
Hieranoid 1 1.000
Homologene 1 1.000 H37649
Inparanoid 1 1.050 468 1.000 Inparanoid score I839
Isobase 1 0.950 0.834419 Normalized mean entropy S396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D423866at33208
OrthoFinder 1 1.000 FOG0001724
OrthoInspector 1 1.000 T97992
orthoMCL 1 0.900 OOG5_127220
Panther 1 1.100 O PTHR45671
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.