DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and ILV2

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_013826.1 Gene:ILV2 SGDID:S000004714 Length:687 Species:Saccharomyces cerevisiae

Alignment Length:617 Identity:143/618 (23%)
Similarity:259/618 (42%) Gaps:132/618 (21%)


  Fly     8 QIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAG-LKYIGMRNEQAACYAAQAIGYLTGKPGVCL 71
            ||..|.:.:|.|:.|||..|..::.:..|...:. ..::..::||.|.:.|:.....:|||||.|
Yeast    96 QIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYARASGKPGVVL 160

  Fly    72 VVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAARPATAAL 136
            |.||||..:|...||:|..:..|::|..|.......|...|||...|.:||...|:.....:...
Yeast   161 VTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVKSVEE 225

  Fly   137 IPLHVEKAVRYATYGRPGVAYLDFPGNI----------------------LQSKAQEASIYKALA 179
            :||.:.:|...||.||||...:|.|.::                      |.|:||:..:.::  
Yeast   226 LPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPIPTKTTLPSNALNQLTSRAQDEFVMQS-- 288

  Fly   180 HPAPPLAYPPHDDVIRAAKLLRQAKRPLVIVGKGSA-YAHAENTLRHFIENTNLPFLPTPMGKGV 243
                         :.:||.|:..||:|::.||.|.. :|.....|:...:...:|...|..|.|.
Yeast   289 -------------INKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTTLQGLGS 340

  Fly   244 VSDTAPQCVS-------SARTLALQKADVVLLLGARLNWILHFGKAPRYDKDVK---------FI 292
            .....|:.:.       :...||:|.||:::.:|||.:..: .|...::..:.:         .|
Yeast   341 FDQEDPKSLDMLGMHGCATANLAVQNADLIIAVGARFDDRV-TGNISKFAPEARRAAAEGRGGII 404

  Fly   293 QVDINPEELHNSVVASVAIQADIRPFAEQLFEQMNAVNFRFGYEQDWWKQLAVKCKQNRDTVQKM 357
            ..:::|:.::..|...:|::.|......::..::..|..|    .:|:.|:. |.|:.    ...
Yeast   405 HFEVSPKNINKVVQTQIAVEGDATTNLGKMMSKIFPVKER----SEWFAQIN-KWKKE----YPY 460

  Fly   358 SLNTETPLNYYAVFHHLRELLPKDTII--VSEGANTMDIGRSMLLN----------------EQP 404
            :...|||.:         ::.|: |:|  :|:.||  |.||.:::.                ..|
Yeast   461 AYMEETPGS---------KIKPQ-TVIKKLSKVAN--DTGRHVIVTTGVGQHQMWAAQHWTWRNP 513

  Fly   405 RHRLDAGTFGTMGVGPGFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVI 469
            ...:.:|..||||.|    :.||:..:...|...|:.::||::|..:..|:.:.|:...||.|:|
Yeast   514 HTFITSGGLGTMGYG----LPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILI 574

  Fly   470 VNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYE----------EMMKMFGMKGYFCTE 524
            :||               ..:|.:||.   .:|..:.||.          ::.:..|:||....:
Yeast   575 LNN---------------EEQGMVTQW---QSLFYEHRYSHTHQLNPDFIKLAEAMGLKGLRVKK 621

  Fly   525 IEQLQAAVKAANQLTDRPTIINVAISPSSDRK 556
            .|:|.|.:|.... |..|.::.|.:    |:|
Yeast   622 QEELDAKLKEFVS-TKGPVLLEVEV----DKK 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 141/612 (23%)
TPP_PYR_POX_like 8..161 CDD:132918 50/154 (32%)
TPP_enzyme_M 195..322 CDD:278628 30/144 (21%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 47/211 (22%)
ILV2NP_013826.1 acolac_lg 92..668 CDD:272915 143/618 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S956
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126899
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.750

Return to query results.
Submit another query.