DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and THI3

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_010203.1 Gene:THI3 SGDID:S000002238 Length:609 Species:Saccharomyces cerevisiae

Alignment Length:636 Identity:139/637 (22%)
Similarity:227/637 (36%) Gaps:166/637 (26%)


  Fly    14 LKQQGVEYVFGIIG---IPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTGKPGVCLVVS- 74
            |.|..:..:||:.|   :|:  |...:....|::.|..||..|.|||.  ||...|...||:.: 
Yeast    25 LNQLNIHTIFGLSGEFSMPL--LDKLYNIPNLRWAGNSNELNAAYAAD--GYSRLKGLGCLITTF 85

  Fly    75 GPGLLHVTGGMANAQVNCWPLIVIGG------ATNQ---DHE-GIGGFQECPQVELSRPYCKYAA 129
            |.|.|....|:|.:......::.|.|      .|.|   .|. |.|.|....:: .|...| |..
Yeast    86 GVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFTVFHRI-ASDVAC-YTT 148

  Fly   130 RPATAALIPLHVEKAVRYA-TYGRPGVAYLDFPGNILQSKAQEASIYKAL---AHPAPPLAYPPH 190
            ....:.|....|:|.::.| ...||  .|:..|.|.:....:.|.:...|   .|...|   ...
Yeast   149 LIIDSELCADEVDKCIKKAWIEQRP--VYMGMPVNQVNLPIESARLNTPLDLQLHKNDP---DVE 208

  Fly   191 DDVI-RAAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVVSDTAPQ---- 250
            .:|| |....:.:::.|.:||...::..:.....:........|...||||||.|::|.||    
Yeast   209 KEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVFVTPMGKGTVNETDPQFGGV 273

  Fly   251 ---CVSSARTL-ALQKADVVLLLGARLNWI----LHF-----GKAPRYDKDVKFIQVDINPEELH 302
               .:|:.... .:..||.::::|..|:..    .||     ..|..|...||          |.
Yeast   274 FTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKTKNCALLYSTSVK----------LK 328

  Fly   303 NSVVASVAIQADIRPFAEQLFEQMNAVNFRFGYE---------------------QDW-WKQLAV 345
            |:....::|:..::.....|.|.      :..|:                     |:| |.::: 
Yeast   329 NATYPDLSIKLLLQKILANLDES------KLSYQPSEQPSMMVPRPYPAGNVLLRQEWVWNEIS- 386

  Fly   346 KCKQNRDTVQKMSLNTETPLNYYAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLNEQPRHRLDA 410
                                      |..:   |.|.||...||:...:.::         |...
Yeast   387 --------------------------HWFQ---PGDIIITETGASAFGVNQT---------RFPV 413

  Fly   411 GTFG-----------TMGVGPGFAVAAALFCRDFAPG--KRVLCVEGDSAFGFSGMEIETMVRYK 462
            .|.|           |||...|...|.....:|..|.  .||:...||.||..:..|:.|:|::.
Yeast   414 NTLGISQALWGSVGYTMGACLGAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWG 478

  Fly   463 LPVTIVIVNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKMFGMKGYFCTEIE- 526
            |...|.::||.    |:..|.|...||:.....|.|.:.||       ::::||     ||..| 
Yeast   479 LTPYIFVMNNQ----GYSVDRFLHHRSDASYYDIQPWNYLG-------LLRVFG-----CTNYET 527

  Fly   527 -------QLQAAVKAANQLT-DRPTIINVAISPSSDRKPQSF--NWLTESK 567
                   :.::.:...|..| |:..:|.:.:.|..  .||:.  .|:.|.:
Yeast   528 KKIITVGEFRSMISDPNFATNDKIRMIEIMLPPRD--VPQALLDRWVVEKE 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 135/618 (22%)
TPP_PYR_POX_like 8..161 CDD:132918 43/162 (27%)
TPP_enzyme_M 195..322 CDD:278628 29/144 (20%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 48/205 (23%)
THI3NP_010203.1 PDC1 12..579 CDD:226470 139/637 (22%)
TPP_PYR_PDC_IPDC_like 19..180 CDD:132921 44/163 (27%)
TPP_enzyme_M 212..>313 CDD:278628 23/101 (23%)
TPP_PDC_IPDC 376..568 CDD:238963 54/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S956
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.