DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and PDC5

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_013235.1 Gene:PDC5 SGDID:S000004124 Length:563 Species:Saccharomyces cerevisiae

Alignment Length:553 Identity:120/554 (22%)
Similarity:227/554 (41%) Gaps:79/554 (14%)


  Fly     1 MAEVEAVQIIAESLKQQGVEYVFGIIG-IPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLT 64
            |:|:...:.:.|.|.|.....|||:.| ..:..|...::..|:::.|..||..|.|||.  ||..
Yeast     1 MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAAD--GYAR 63

  Fly    65 GKPGVCLVVS-GPGLLHVTGGMANA---QVNCWPLIVIGGATNQD-----HEGIGGFQECPQVEL 120
            .|...|::.: |.|.|....|:|.:   .|....::.:...::|.     |..:|.........:
Yeast    64 IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHRM 128

  Fly   121 SRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAHPAPPL 185
            |....:..|.....|..|..:::.:| .||......||..|.|::     :.::...|......|
Yeast   129 SANISETTAMITDIANAPAEIDRCIR-TTYTTQRPVYLGLPANLV-----DLNVPAKLLETPIDL 187

  Fly   186 AYPPHD-----DVIR-AAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVV 244
            :..|:|     :|:| ..:|::.||.|:::....::....:...:..::.|..|...||||||.:
Yeast   188 SLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQFPVYVTPMGKGAI 252

  Fly   245 SDTAPQ-------CVSSART-LALQKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINPEEL 301
            .:..|:       .:|.... .|::.||::|.:||.|: ..:.|......|....::...:..::
Yeast   253 DEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLS-DFNTGSFSYSYKTKNIVEFHSDHIKI 316

  Fly   302 HNSVVASVAIQADIRPFAEQLFEQMNAVNFRFGYEQDWWKQLAVKCKQNRDTVQKMSLNTETPLN 366
            .|:....|.::..::...:.:.|.:..           :|.:||..   |..:.| |....||:.
Yeast   317 RNATFPGVQMKFALQKLLDAIPEVVKD-----------YKPVAVPA---RVPITK-STPANTPMK 366

  Fly   367 YYAVFHHLRELLPKDTIIVSE-GANTMDIGRSMLLNEQPRHRLDAGTFGTMGVGPGFAVAAALFC 430
            ...:::||...|.:..|:::| |.:...|.::....:.  :.:....:|::|...|..:.|.:..
Yeast   367 QEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDV--YAIVQVLWGSIGFTVGALLGATMAA 429

  Fly   431 RDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVIVNNNGIYGGFDKDTFEAIRSEGDLTQ 495
            .:..|.|||:...||.:...:..||.||:|:.|...|.::||||.       |.|.:        
Yeast   430 EELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGY-------TIEKL-------- 479

  Fly   496 ITPPSALGVQVRYEE--------MMKMFGMKGY 520
            |..|.|     .|.|        ::..||.:.|
Yeast   480 IHGPHA-----EYNEIQGWDHLALLPTFGARNY 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 118/547 (22%)
TPP_PYR_POX_like 8..161 CDD:132918 38/163 (23%)
TPP_enzyme_M 195..322 CDD:278628 26/136 (19%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 38/164 (23%)
PDC5NP_013235.1 PDC1 1..563 CDD:226470 120/554 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S956
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.