DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and CSR1

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_190425.1 Gene:CSR1 AraportID:AT3G48560 Length:670 Species:Arabidopsis thaliana

Alignment Length:591 Identity:149/592 (25%)
Similarity:267/592 (45%) Gaps:84/592 (14%)


  Fly     5 EAVQIIAESLKQQGVEYVFGIIGIPVIELSMAF-QAAGLKYIGMRNEQAACYAAQAIGYLTGKPG 68
            :...|:.|:|::||||.||...|...:|:..|. :::.::.:..|:||...:||:.....:||||
plant    98 KGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPG 162

  Fly    69 VCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAARPAT 133
            :|:..||||..::..|:|:|.::..||:.|.|...:...|...|||.|.||::|...|:......
plant   163 ICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMD 227

  Fly   134 AALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKA----QEASIYKALAHPAPPLAYPPHDDVI 194
            ...||..:|:|...||.||||...:|.|.:|.|..|    ::|..........|.   ||.|..:
plant   228 VEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPK---PPEDSHL 289

  Fly   195 -RAAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVV---SDTAPQCVSSA 255
             :..:|:.::|:|::.||.|.  .::.:.|..|:|.|.:|...|.||.|..   .:.:...:...
plant   290 EQIVRLISESKKPVLYVGGGC--LNSSDELGRFVELTGIPVASTLMGLGSYPCDDELSLHMLGMH 352

  Fly   256 RTL----ALQKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINPEELHNSVVASVAIQADIR 316
            .|:    |::.:|::|..|.|.:..: .||...:....|.:.:||:..|:..:....|::..|::
plant   353 GTVYANYAVEHSDLLLAFGVRFDDRV-TGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVK 416

  Fly   317 PFAEQLFEQMNAV--------NFRFGYEQDWWKQLAVKCKQNRDTVQKMSLNTETPLNY------ 367
                ...:.||.|        ...||.    |:        |...|||...    ||::      
plant   417 ----LALQGMNKVLENRAEELKLDFGV----WR--------NELNVQKQKF----PLSFKTFGEA 461

  Fly   368 ----YAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLN-EQPRHRLDAGTFGTMGVGPGFAVAAA 427
                ||:  .:.:.|.....|:|.|.....:..:...| ::||..|.:|..|.||.|...|:.|:
plant   462 IPPQYAI--KVLDELTDGKAIISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGAS 524

  Fly   428 LFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVIVNNN--GIYGGFDKDTFEAIRSE 490
            :    ..|...|:.::||.:|..:..|:.|:....|||.::::||.  |:...::...::|.|:.
plant   525 V----ANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAH 585

  Fly   491 GDLTQITPPSALGVQVRYEEM---MKMF----GMKGYFCTEIEQLQAAVKAANQLTDRPTIINVA 548
                     :.||...:.:|:   |.:|    |:.....|:...|:.|::.... |..|.:::| 
plant   586 ---------TFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLD-TPGPYLLDV- 639

  Fly   549 ISPSSD 554
            |.|..:
plant   640 ICPHQE 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 149/585 (25%)
TPP_PYR_POX_like 8..161 CDD:132918 53/154 (34%)
TPP_enzyme_M 195..322 CDD:278628 29/134 (22%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 45/203 (22%)
CSR1NP_190425.1 PLN02470 85..670 CDD:215261 149/592 (25%)
TPP_PYR_POX_like 101..256 CDD:132918 54/155 (35%)
TPP_enzyme_M 289..420 CDD:278628 29/138 (21%)
TPP_AHAS 462..654 CDD:238973 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126899
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.