DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and hacl1

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_998250.1 Gene:hacl1 ZFINID:ZDB-GENE-040426-2058 Length:568 Species:Danio rerio

Alignment Length:568 Identity:316/569 (56%)
Similarity:416/569 (73%) Gaps:0/569 (0%)


  Fly     1 MAEVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTG 65
            |.||...|:||.:||.|.|||:|||:|:|:||::||.||||:||:||||||||||||.|||||||
Zfish     1 MDEVTGAQLIAAALKDQNVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAIGYLTG 65

  Fly    66 KPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAAR 130
            :|.||||||||||:|..||||||.|||||:||:||:::::.|..|.|||.||||..|.|.|::||
Zfish    66 RPAVCLVVSGPGLIHALGGMANANVNCWPVIVLGGSSDRNQETTGAFQEFPQVEACRLYSKFSAR 130

  Fly   131 PATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAHPAPPLAYPPHDDVIR 195
            |::..:||..||||||.:.|||||..|:|..|:::.:|...|::......||||::.....::.:
Zfish   131 PSSLEMIPAVVEKAVRSSIYGRPGACYIDIAGDMVNAKIDRATVRFVSCCPAPPVSQADCREITQ 195

  Fly   196 AAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVVSDTAPQCVSSARTLAL 260
            |.:||:.::.||:|:|||:|||.||..:|..:|.|.:|||||||||||:.|..|.||::||:.||
Zfish   196 AVRLLKTSQSPLIIIGKGAAYARAEKEVRELVEVTGIPFLPTPMGKGVLPDDHPNCVAAARSRAL 260

  Fly   261 QKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINPEELHNSVVASVAIQADIRPFAEQLFEQ 325
            .:|||::|||||||||||||..||:..:||.||||:..|||.|:|.|:.|:..||:....||.|.
Zfish   261 LQADVIVLLGARLNWILHFGFPPRFSANVKIIQVDLCAEELSNNVRAASALLGDIKMVTSQLLET 325

  Fly   326 MNAVNFRFGYEQDWWKQLAVKCKQNRDTVQKMSLNTETPLNYYAVFHHLRELLPKDTIIVSEGAN 390
            :.:.::||..:..||..|..|...|....:.:||.|..|:|||..|||:.||||||.||||||||
Zfish   326 VRSESWRFPSDSQWWATLREKITANAQITKALSLQTTLPMNYYTAFHHISELLPKDCIIVSEGAN 390

  Fly   391 TMDIGRSMLLNEQPRHRLDAGTFGTMGVGPGFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEI 455
            ||||||:||||..||||||||||||||||||||:|||:..:....|::|:||||||||||||||.
Zfish   391 TMDIGRTMLLNHLPRHRLDAGTFGTMGVGPGFAIAAAVLEQAQRFGQKVVCVEGDSAFGFSGMEA 455

  Fly   456 ETMVRYKLPVTIVIVNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKMFGMKGY 520
            |||.|||||:.|:::||||||.|.|.:|::|:...||:|.|.||..|..:.|||::|..||..||
Zfish   456 ETMCRYKLPIIIIVINNNGIYSGVDPETWKAMEKMGDMTTIAPPVTLLPEARYEQVMSAFGGHGY 520

  Fly   521 FCTEIEQLQAAVKAANQLTDRPTIINVAISPSSDRKPQSFNWLTESKL 568
            ....:|:|:.|::.:.:.|..|:::||.|.|:||||.|.|.|||.|.|
Zfish   521 LVRTVEELRTALQDSLKNTQMPSLLNVLIDPTSDRKQQEFPWLTRSNL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 302/544 (56%)
TPP_PYR_POX_like 8..161 CDD:132918 100/153 (65%)
TPP_enzyme_M 195..322 CDD:278628 70/127 (55%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 110/183 (60%)
hacl1NP_998250.1 PRK09259 5..552 CDD:236433 302/547 (55%)
TPP_PYR_POX_like 8..160 CDD:132918 100/152 (66%)
TPP_enzyme_M 193..322 CDD:278628 70/129 (54%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 110/183 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188502503
eggNOG 1 0.900 E1_COG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5794
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D158397at33208
OrthoFinder 1 1.000 FOG0004355
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126899
Panther 1 1.100 LDO PTHR43710
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.