DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and SPBC725.04

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_595484.1 Gene:SPBC725.04 PomBaseID:SPBC725.04 Length:568 Species:Schizosaccharomyces pombe

Alignment Length:569 Identity:231/570 (41%)
Similarity:348/570 (61%) Gaps:19/570 (3%)


  Fly     8 QIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTGKPGVCLV 72
            :::|::|....|:.||||:||||||:..|.||:|::::|.||||:|.|||.|.||||.:||||:|
pombe     7 ELVAKTLLDLEVKVVFGIVGIPVIEICEAIQASGIRFVGFRNEQSAAYAATAYGYLTQRPGVCVV 71

  Fly    73 VSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAARPATAALI 137
            |.|||::|...|:.|::.|.|||:::.|::....:..|.|||..||....|:.|.|.||.:..::
pombe    72 VGGPGVVHAMAGVFNSKTNRWPLLLLAGSSETFQQNCGAFQELDQVSYLSPHTKLAVRPPSPKMV 136

  Fly   138 PLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAHPAPPLAYPPHDDVIRAAKLLRQ 202
            ...:.:|.|.:..|.||..|:|.|.|.::|...:.........|:.|...|....:.:||..|:.
pombe   137 VDSIRRAYRVSMTGTPGTCYVDLPANYIESTVDDFPKDPLPPIPSSPKCAPDPTQLQKAAYYLKN 201

  Fly   203 AKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVVSDTAPQCVSSARTLALQKADVVL 267
            ||.||::||||:|||.||..|..|:|:|.:||||:|||||::.::.|..|||||:.||:.|||||
pombe   202 AKAPLLVVGKGAAYACAEKQLLEFVEHTGIPFLPSPMGKGLLPESHPLNVSSARSAALRNADVVL 266

  Fly   268 LLGARLNWILHFGKAPRYDKDVKFIQVDINPEEL-HNSVVASVAIQADIRPFAEQLFEQMNAVNF 331
            |.|||||||..:|..|::..:.||||:|.|.|.| :|:....:||.||:....:.||:.:....:
pombe   267 LAGARLNWIFQYGLPPKWSPNAKFIQIDTNAETLGNNAADLDLAIWADVGLTIDCLFKLVQTWKY 331

  Fly   332 RFGYEQDWWKQL-AVKCKQNRDTVQKMSLNTETPLNY--YAVFHHLRELLPK---DTIIVSEGAN 390
            ..|....:.:.| ..:.|..:..::....:....:||  |.|...|:.|..|   :...||||||
pombe   332 SVGISTPYLRTLNETRSKNEKKALESRKSSIPLQMNYALYVVNEELQSLSLKSKRNITWVSEGAN 396

  Fly   391 TMDIGRSMLLNEQPRHRLDAGTFGTMGVGPGFAVAAALFCRDFA-PGKRVLCVEGDSAFGFSGME 454
            |||.||.:|....||.||||||..|||||.|:|:|:|     || ...:::.||||||||||.||
pombe   397 TMDRGRQLLEVTHPRGRLDAGTMSTMGVGMGYAIASA-----FAHSSDKIVVVEGDSAFGFSAME 456

  Fly   455 IETMVRYKLPVTIVIVNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKMFGMKG 519
            :||.:|.:|.:.::::||||:|.|.|.|.:|.:|....|    |.:|||..:||:::.:..|.||
pombe   457 LETAIRNQLDLLVIVINNNGVYHGLDTDAYETLRDNHQL----PTTALGTSIRYDQICEACGGKG 517

  Fly   520 YFCTEIEQLQAAVKAANQLTDRPTIINVAISPSSDRKPQSFNWLTESKL 568
            :|....|.|:::::.|.| |...::|||.:.|.:.|| .:|.|::.:|:
pombe   518 FFVKNEEDLRSSLRKAWQ-TSSVSLINVMVDPEAARK-LTFAWMSSTKV 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 226/552 (41%)
TPP_PYR_POX_like 8..161 CDD:132918 66/153 (43%)
TPP_enzyme_M 195..322 CDD:278628 65/128 (51%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 82/189 (43%)
SPBC725.04NP_595484.1 TPP_PYR_POX_like 7..161 CDD:132918 67/154 (44%)
PRK09259 8..550 CDD:236433 226/552 (41%)
TPP_enzyme_M 192..322 CDD:278628 65/130 (50%)
TPP_BZL_OCoD_HPCL 367..547 CDD:238962 83/190 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5794
Inparanoid 1 1.050 425 1.000 Inparanoid score I330
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004355
OrthoInspector 1 1.000 T1124718
orthoMCL 1 0.900 OOG5_126899
Panther 1 1.100 LDO PTHR43710
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1849
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.