DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and Ilvbl

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001346230.1 Gene:Ilvbl MGIID:1351911 Length:642 Species:Mus musculus

Alignment Length:613 Identity:169/614 (28%)
Similarity:278/614 (45%) Gaps:87/614 (14%)


  Fly     1 MAEVEAVQI------IAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQA 59
            |.:|:...|      :|..|:..||.:||.::|..:..|.:|.:..|::.:..|:|..|.:||.|
Mouse    53 MHKVDKTSIRHGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADA 117

  Fly    60 IGYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPY 124
            :..|||..||..|.:||||.:....:.||||...|::::|||.:...:..|..|...|:.|.||.
Mouse   118 VARLTGTVGVAAVTAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPL 182

  Fly   125 CKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFP------------------------GNIL 165
            ||:.|.......|...:..|:..|..|.||..:::.|                        |.::
Mouse   183 CKFCASVRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVV 247

  Fly   166 QSKAQE--ASIYKALAHPAP----PLAYP--PHDDVIRAAKLLRQAKRPLVIVGKGSAYAHA-EN 221
            ....|.  |:::.....|.|    ||..|  ....|.|..::|.:|||||:::|..:..... .|
Mouse   248 VWYLQNCLANLFVGAWEPRPEGPLPLDIPQASPQQVQRCVEILSRAKRPLLVLGSQALLPPTPAN 312

  Fly   222 TLRHFIENTNLPFLPTPMGKGVVSDTAPQCVSSARTLALQKADVVLLLGARLNWILHFGKAPRYD 286
            .||..:|...:|.....|.:|::....|..:...|:.||:|||||:|.||..::.|.:|:.  .:
Mouse   313 KLRAAVETLGVPCFLGGMSRGLLGRNHPLHIRQNRSAALKKADVVVLAGAVCDFRLSYGRV--LN 375

  Fly   287 KDVKFIQVDINPEE-LHNSVV---ASVAIQADIRPFAEQLFE----QMNAVNFRFGYEQDWWKQL 343
            :....|.|:.|.:: |.||.:   ...|:|.|:..|..:|.|    ||        :..||.::|
Mouse   376 RKSSIIIVNRNRDDLLLNSDIFWKPQEAVQGDVGSFMIKLVEGLQGQM--------WSSDWAEEL 432

  Fly   344 AVKCKQNRDTVQKMSLNTETP----LNYYAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLNEQP 404
            ....:|...|.:..:|   .|    ||...|...:.|.||.:.::|.:|.:.:.....::....|
Mouse   433 RKADQQKEQTYRDKAL---MPVLQHLNPVWVLQQVEETLPDNALLVVDGGDFVATAAYLVQPRGP 494

  Fly   405 RHRLDAGTFGTMGVGPGFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVI 469
            ...||.|.|||:|||.|||:.|.| |:   |...|.|:.||.|||:|.:|.:|.||:|:|| |.:
Mouse   495 LRWLDPGAFGTLGVGAGFALGAKL-CQ---PEAEVWCLFGDGAFGYSLIEFDTFVRHKVPV-IAL 554

  Fly   470 VNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKM---FGMKGYFCT--EIEQLQ 529
            |.|:   .|:.:.:.|.:...|        |.:...:.|.:..|.   .|.:|...:  ..:|:.
Mouse   555 VGND---AGWTQISREQVPRLG--------SDVACSLAYTDYHKAAMGLGAQGLILSRDNKDQVV 608

  Fly   530 AAVKAANQLTD--RPTIINVAISPSSDR 555
            ..::...||..  ...::|:.|..:..|
Mouse   609 KVLREGQQLCQDGHAVVVNILIGRTDFR 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 166/602 (28%)
TPP_PYR_POX_like 8..161 CDD:132918 50/159 (31%)
TPP_enzyme_M 195..322 CDD:278628 39/132 (30%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 54/190 (28%)
IlvblNP_001346230.1 IlvB 63..596 CDD:333018 159/562 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126899
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.