DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hacl and ILVBL

Sequence 1:NP_611460.1 Gene:Hacl FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_024307098.1 Gene:ILVBL HGNCID:6041 Length:661 Species:Homo sapiens

Alignment Length:621 Identity:164/622 (26%)
Similarity:274/622 (44%) Gaps:98/622 (16%)


  Fly    10 IAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTGKPGVCLVVS 74
            :|..|:..||.::|.::|..:..|.:|.:..|::.:..|:|..|.:||.|:..|:|..||..|.:
Human    58 VAAVLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTA 122

  Fly    75 GPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSRPYCKYAARPATAALIPL 139
            ||||.:....:.|||:...|::::|||.:...:..|..|...|:.|.||.||:.........|..
Human   123 GPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVP 187

  Fly   140 HVEKAVRYATYGRP-----------------------------GVAYLDFPGNIL---------- 165
            .:..|:..|..|.|                             |..:::.|.::|          
Human   188 TLRAAMAAAQSGTPGRWRMVMLSSAGAEGLGTCYGLSVLPVPAGPVFVELPVDVLYPYFMVQKEM 252

  Fly   166 -QSKAQE---------------ASIYKALAHPAP----PLAYP--PHDDVIRAAKLLRQAKRPLV 208
             .:|..:               |:::.....|.|    ||..|  ....|.|..::|.:|||||:
Human   253 VPAKPPKGLVGRVVSWYLENYLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVEILSRAKRPLM 317

  Fly   209 IVGKGSAYA-HAENTLRHFIENTNLPFLPTPMGKGVVSDTAPQCVSSARTLALQKADVVLLLGAR 272
            ::|..:... .:.:.||..:|...:|.....|.:|::....|..:...|:.||:||||::|.|..
Human   318 VLGSQALLTPTSADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTV 382

  Fly   273 LNWILHFGKAPRYDKDVKFIQVDINPEE-LHNSVV---ASVAIQADIRPFAEQLFEQMNAVNFRF 333
            .::.|.:|:...:..  |.|.|:.|.|| |.||.:   ...|:|.|:..|..:|.|.:....   
Human   383 CDFRLSYGRVLSHSS--KIIIVNRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQT--- 442

  Fly   334 GYEQDWWKQLAVKCKQNRDTV-QKMSLNTETPLNYYAVFHHLRELLPKDTIIVSEGANTMDIGRS 397
             :..||.::|....:|...|. :|.::.....||...|...:.|.||.::|:|.:|.:.:.....
Human   443 -WAPDWVEELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAH 506

  Fly   398 MLLNEQPRHRLDAGTFGTMGVGPGFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYK 462
            ::....|...||.|.|||:|||.|||:.|.| ||   |...|.|:.||.|||:|.:|.:|.||:|
Human   507 LVQPRGPLRWLDPGAFGTLGVGAGFALGAKL-CR---PDAEVWCLFGDGAFGYSLIEFDTFVRHK 567

  Fly   463 LPVTIVIVNNNGIYGGFDKDTFEAIRSEGDLTQITPPSALGVQVRYEEMMKM---FGMKGYFCTE 524
            :||..::.|:    .|:.:.:.|.:.|.|        |.:...:.|.:..|.   .|.:|...:.
Human   568 IPVMALVGND----AGWTQISREQVPSLG--------SNVACGLAYTDYHKAAMGLGARGLLLSR 620

  Fly   525 IEQLQAAVK----AANQLTD-RPTIINVAISPSSDR 555
             |.....||    |..|..| .|.::|:.|..:..|
Human   621 -ENEDQVVKVLHDAQQQCRDGHPVVVNILIGRTDFR 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 163/617 (26%)
TPP_PYR_POX_like 8..161 CDD:132918 45/180 (25%)
TPP_enzyme_M 195..322 CDD:278628 39/132 (30%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962 59/191 (31%)
ILVBLXP_024307098.1 IlvB 53..648 CDD:333018 162/613 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126899
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.