DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG34428

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:96/259 - (37%) Gaps:68/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILFLFTLEAVSALEANLTSWRHHRRQKR----FLIYQNGGV--IKFVSGCAFPAPFMEKKA---- 62
            |:|:.....:..:.|:|.|...|:|.||    :|||.....  :.|:.|...|...:..:|    
  Fly     5 IVFILVSCLLYQVMASLGSLFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLEDLNYEAVTTG 69

  Fly    63 --WRQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKG-PLTQPAPPSVPA--------------- 109
              .:...||         |.||       |..|.... ||||.|.|.|..               
  Fly    70 YVLKVEYWL---------PTTP-------DDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVG 118

  Fly   110 ---------RLLVDEPQLL------LFKFAEAYMNQLGQNGSACLDRLICENGQVDEH--SGLYA 157
                     :||....::|      ::|..|...::||..|..|:.:.|||..:...|  :||:|
  Fly   119 VDELGKNTRKLLTRTNKVLSSYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFA 183

  Fly   158 QLLHRLLRPHQTLDV-------RYLDAYRMGRHGVDCRNAFPEAHHCILDDYLHLHERGPKQSF 214
            .|||.||.|..::|.       .|..|.:||:.|..|...|.|....:|..:..||....|..|
  Fly   184 DLLHILLTPSSSVDKLSEHADNEYYYAEKMGQSGAGCDRVFKECRRSLLQHFSELHHNLDKILF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 30/104 (29%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.