DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34428

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster

Alignment Length:259 Identity:66/260 (25%)
Similarity:96/260 (37%) Gaps:68/260 (26%)


  Fly     8 ILFLFTLEAVSALEANLTSWRHHRRQKR----FLIYQNGGV--IKFVSGCAFPAPFMEKKA---- 62
            |:|:.....:..:.|:|.|...|:|.||    :|||.....  :.|:.|...|...:..:|    
  Fly     5 IVFILVSCLLYQVMASLGSLFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLEDLNYEAVTTG 69

  Fly    63 --WRQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKG-PLTQPAPPSVPA--------------- 109
              .:...||         |.||       |..|.... ||||.|.|.|..               
  Fly    70 YVLKVEYWL---------PTTP-------DDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVG 118

  Fly   110 ---------RLLVDEPQLL------LFKFAEAYMNQLGQNGSACLDRLICENGQVDEH--SGLYA 157
                     :||....::|      ::|..|...::||..|..|:.:.|||..:...|  :||:|
  Fly   119 VDELGKNTRKLLTRTNKVLSSYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFA 183

  Fly   158 QLLHRLLRPHQTLDV-------RYLDAYRMGRHGVDCRNAFPEAHHCILDDYLHLHERGPKQSF 214
            .|||.||.|..::|.       .|..|.:||:.|..|...|.|....:|..:..||....|..|
  Fly   184 DLLHILLTPSSSVDKLSEHADNEYYYAEKMGQSGAGCDRVFKECRRSLLQHFSELHHNLDKILF 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 30/105 (29%)
CG34428NP_001097597.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48191
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.