DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34444

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster

Alignment Length:209 Identity:45/210 (21%)
Similarity:74/210 (35%) Gaps:82/210 (39%)


  Fly    29 HHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHYQFNEPQTPIYWWKLWDGSR 93
            ||.::|:....:.|.|||         |                  |.|:|:           .:
  Fly   119 HHDKKKKKSKPKPGSVIK---------P------------------QKNKPK-----------HK 145

  Fly    94 NLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQN------------------------ 134
            :.|...::|.||..     |||.....| |....::.:|::                        
  Fly   146 HKKKHKSKPKPPPE-----VDEDDYKDF-FQGFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRF 204

  Fly   135 -------GSACLDRLICE--NGQVDEHSGLYAQLLHRLLRP----HQTLDVRYLDAYRMGRHGVD 186
                   |.:||.|||||  :.|:.:.:|:...|:|.:..|    ::.|..||..|...||:| :
  Fly   205 ELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKRYYIAELDGRNG-N 268

  Fly   187 CRNAFPEAHHCILD 200
            |.....:..|.:||
  Fly   269 CGGYRVQCEHSVLD 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 29/125 (23%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48746
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.