DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34429

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster

Alignment Length:85 Identity:27/86 (31%)
Similarity:42/86 (49%) Gaps:9/86 (10%)


  Fly   134 NGSACLDRLICENGQV--DEHSGLYAQLLHRLLRPHQTLDV-------RYLDAYRMGRHGVDCRN 189
            ||..|:.:.|||:...  |:.:||..::||.||.|..::|.       .||.|.|:|..|.||..
  Fly   157 NGRVCVLKSICESAAAPFDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQ 221

  Fly   190 AFPEAHHCILDDYLHLHERG 209
            .:|.....:|:.:..:|..|
  Fly   222 VYPRCPKSLLEHFSDVHHLG 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 25/79 (32%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48139
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.