DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34442

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster

Alignment Length:79 Identity:23/80 (29%)
Similarity:32/80 (40%) Gaps:6/80 (8%)


  Fly   128 MNQLGQNGSACLDRLICEN--GQVDEHSGLYAQLLHRLLRPHQTLDV----RYLDAYRMGRHGVD 186
            :.:.|.....||.||||:.  .|:.|.:|....|:|.:..|..:.|.    .|..|...||...:
  Fly   147 LRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYYQAEWDGREQQE 211

  Fly   187 CRNAFPEAHHCILD 200
            |........|.|||
  Fly   212 CSTYTKSCDHNILD 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 23/80 (29%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48826
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.