DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG34442

DIOPT Version :10

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:79 Identity:23/79 - (29%)
Similarity:32/79 - (40%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MNQLGQNGSACLDRLICEN--GQVDEHSGLYAQLLHRLLRPHQTLDV----RYLDAYRMGRHGVD 186
            :.:.|.....||.||||:.  .|:.|.:|....|:|.:..|..:.|.    .|..|...||...:
  Fly   147 LRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYYQAEWDGREQQE 211

  Fly   187 CRNAFPEAHHCILD 200
            |........|.|||
  Fly   212 CSTYTKSCDHNILD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 23/79 (29%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:462285 19/71 (27%)

Return to query results.
Submit another query.