DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34443

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster

Alignment Length:226 Identity:56/227 (25%)
Similarity:81/227 (36%) Gaps:81/227 (36%)


  Fly    12 FTLEAVSALEANLTSWRHHRRQKRFLIYQNGGV--------------IKFVSGCAFPAPFMEKKA 62
            :..||...|.||...|         .|:|||.:              .|..:||.......|.:|
  Fly    54 YNFEANYNLPANWEKW---------TIFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEA 109

  Fly    63 WRQLVWLMNFHYQFNE--PQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAE 125
            ..:.|      .:..|  ||           .|.::..||:    |...|:.||:          
  Fly   110 GSEEV------EEITEVLPQ-----------ERKVRSLLTR----SNIYRIFVDK---------- 143

  Fly   126 AYMNQLGQNGSACLDRLICEN--GQVDEHSGLYAQLLHRLLRP----HQTLDVRYLDAYRMGRHG 184
              :.:.|..|.:||.|||||.  .|:||.:|:...|:|.|..|    .:.|.:||..|...|.:|
  Fly   144 --LKRSGFRGESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRYYQAEHDGWNG 206

  Fly   185 VDCRNAFPEAHHCILDDYLHLHERGPKQSFL 215
                       ||      |::|.|..:|.|
  Fly   207 -----------HC------HVYEPGCGESIL 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 26/96 (27%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 32/115 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48677
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.