DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG34184

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster

Alignment Length:202 Identity:44/203 (22%)
Similarity:73/203 (36%) Gaps:57/203 (28%)


  Fly    37 LIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHYQFN--EPQ-----TPIYWWKLWD---- 90
            |:||...........:.|.....:..:      ::::|:||  :|:     .||.....|:    
  Fly    21 LLYQTNSEFGIFMAISVPLTLKNRNVF------LSYNYEFNYYQPEHVYKYPPILMGDNWEDSYL 79

  Fly    91 -----------GSRNLK----GPLTQPAPPSVPAR-----LLVDEPQLLLFKFAEAYMNQLGQNG 135
                       .||:.:    ...||.....:.:|     :|.|:            :.:.|...
  Fly    80 TYNTTGGDDSSSSRSFRSVDDNSSTQKRTLPIMSRTNFYIMLKDK------------LERSGYPA 132

  Fly   136 SACLDRLICE--NGQVDEHSGLYAQLLHRLLRP----HQTLDVRYLDAYRMG-RHGVDCRNAFPE 193
            .:||.|||||  :..:.|.:||...::|.|..|    .:.||..|..|...| ||| ||.....:
  Fly   133 ESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSSSNDENLDKDYYQAEWDGLRHG-DCSFYASQ 196

  Fly   194 AHHCILD 200
            ....:||
  Fly   197 CEENVLD 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 27/95 (28%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48782
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.