DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG42812

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster

Alignment Length:209 Identity:50/210 (24%)
Similarity:72/210 (34%) Gaps:59/210 (28%)


  Fly    36 FLIYQNGGVIKFVSGCAFPA------------PFMEKKAWRQLV--WLMNFHYQFNEPQTPIYWW 86
            |||:|:..::       :||            |..|....|:::  |.....|.:....|..|..
  Fly    14 FLIHQSSSLL-------WPASSNLGLTLSVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSI 71

  Fly    87 KLWDGSRNLKGPLTQPAPPSVPARLLVDE---------------PQLL----LFKFAEAYMNQLG 132
            .:|.|..|.|      |...||...:.||               |:..    |:.|.|..:...|
  Fly    72 PIWPGFANYK------AKREVPQLEMTDENFYTKYGHDNGNGMHPKDFSAGELYAFLEDTLTGYG 130

  Fly   133 QNGSACLDRLICENGQ---VDEHSGLYAQLLHRLLRPHQTLDVR-----YLDAYRM----GRHGV 185
            .: ..||.|.:||..|   .|.|..|.:.::..:|.|.|....|     |..||.:    |..|.
  Fly   131 FH-ETCLLRSVCELAQHPFDDSHQHLLSDIVTFVLSPSQHEGFRDDEDVYRKAYELAEQDGFLGR 194

  Fly   186 DCRNAFPEAHHCIL 199
            ||...:....|.||
  Fly   195 DCLRLYSHCKHDIL 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 30/118 (25%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.