DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG13616

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster


Alignment Length:189 Identity:42/189 - (22%)
Similarity:70/189 - (37%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RRQKRFLIYQNGGVIKFVSGCA------FPAPFMEKKAWRQLVWLMNFHYQFNEPQTPIYWWKLW 89
            ||.||:|.:..|   ..|||..      ...|.::     .|.|.:|:...::.|.   :.|.: 
  Fly    43 RRHKRYLAFPEG---SSVSGAVCMTIGMIGNPDVD-----YLSWAVNWGVAYDLPN---HQWVI- 95

  Fly    90 DGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICENGQVDEHSG 154
            ..:..|...|.:........|...||.|.|        .:.:|.||.:|:.|.:||:.:....|.
  Fly    96 QHAHGLNATLAKDTIKRRSRRAFYDEVQSL--------FDNMGFNGRSCVARALCESAKFMLPSV 152

  Fly   155 LYAQLLHRLLRPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILDDYLHLHERGPKQS 213
            ....:|..|:|...:|....:.|:.            |:|||    .|..::.|..:.|
  Fly   153 ERGNMLQELVRTVFSLPPSPVAAHE------------PQAHH----QYDRIYRRSKRSS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 22/89 (25%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.