DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG5768

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_651260.3 Gene:CG5768 FlyBaseID:FBgn0039198 Length:262 Species:Drosophila melanogaster

Alignment Length:227 Identity:46/228 (20%)
Similarity:76/228 (33%) Gaps:77/228 (34%)


  Fly    25 TSWRHHRRQKRFLIYQNG-----------GVI-----KFVS-----GCAFPAPFMEKKAWRQLVW 68
            :|.|...|.|||:.:..|           |||     .::|     |.|:..|        .:.|
  Fly    75 SSQRKLSRGKRFVAFPQGSSASGAVCLTTGVIGNPNLLYLSLGINWGVAYDLP--------NVTW 131

  Fly    69 -LMNFHYQFNEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLG 132
             |.|.|.              |...::.:..:.:.....:..||             |..::.:|
  Fly   132 VLQNAHG--------------WTTKKSAQAQIKRRHRRELYGRL-------------ETMIDSMG 169

  Fly   133 QNGSACLDRLICENGQVDEHSGLYAQLLHRLLRP--------------HQTLD-VRYLDAYRMGR 182
            .||..|:.|.:||:.|..:.:.:  .::..:||.              |:..| |.|..||| ..
  Fly   170 YNGRDCILRTLCESRQYFQRTKM--SMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYR-NA 231

  Fly   183 HGVDCRNAFPEAHHCILDDYLHLHERGPKQSF 214
            |..||...  ..|..:|:.....:...||..:
  Fly   232 HTDDCTQY--NCHFSLLELAFGKYTTPPKNYY 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 23/105 (22%)
CG5768NP_651260.3 DM4_12 149..248 CDD:214785 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49132
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.