DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG17781

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster


Alignment Length:208 Identity:44/208 - (21%)
Similarity:76/208 - (36%) Gaps:65/208 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGCAFPAPFMEKKA---WRQLV--------WLMN---FHYQFNEPQTPIYWWKLWDGSRNLKGPL 99
            |..|.||.:..:::   |:|.|        |..|   ....:.|.|. |:....||.:.:.:...
  Fly   222 SQAAIPANWHARQSPAEWQQRVKTTGADNWWTRNGQRVQQNWREKQR-IWGPSKWDYAYSQRPRE 285

  Fly   100 TQPAPPS---VPA------RLLVDEP---------------QLLLFKFAEAYMNQLGQNGSACLD 140
            ...|||.   .|.      |..:|:.               |||..|....|.:: ..||::|:.
  Fly   286 VLRAPPKHHIYPVFARRRRRRSLDQDAHFERLHLQQHLSSRQLLFGKIERLYKSR-RLNGTSCVL 349

  Fly   141 RLICENGQVDEH----------SGLYAQLLHRLLRPHQTLDV------------RYLDAYRMGRH 183
            |.:||:.|..:|          .....::|..:.:...:.||            .||:|:|  :.
  Fly   350 RALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPSSDDVEELEELELMISPNYLEAHR--QK 412

  Fly   184 GVDCRNAFPEAHH 196
            | :||..:.:.:|
  Fly   413 G-NCRQIYGDCNH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 25/120 (21%)
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.