DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG14720

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster

Alignment Length:223 Identity:51/224 (23%)
Similarity:85/224 (38%) Gaps:61/224 (27%)


  Fly     1 MNLLAKIILFLFTLEAVSALEANLTSWRHHRRQKRFLIY--QNGGVIKFVSGCAFPAPFMEKKAW 63
            |.|...|..||..:...||       ..|.:|..|.||:  .:...::|:.|...|         
  Fly     1 MRLEVAIYAFLSCMHLCSA-------DGHLKRLSRSLIFPPTSPTRVQFIGGIGIP--------- 49

  Fly    64 RQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLV----------DEP-- 116
                 :.|.|:   |..|..|         .||.....|...:...|:.:          :.|  
  Fly    50 -----VENLHF---ESVTSGY---------VLKAEYFLPTNSTEITRVYLKPMAITGREKESPYG 97

  Fly   117 ---QLLLFKFAEAYMNQLGQNGSACLDRLICENG--QVDEHSGLYAQLLHRLLRPH-------QT 169
               :.::::..|..:..:|..|.:||.|||||:.  .::..|||..::::.:|||.       |:
  Fly    98 ALYRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQS 162

  Fly   170 LDVRYLDAYRMGRHGVDCRNAFPEAHHC 197
            .|..|..:...|:.|.||:.|:  |..|
  Fly   163 SDREYHTSEHFGKRGGDCQAAY--ASRC 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 27/99 (27%)
CG14720NP_650108.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48162
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.