DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG14115

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster

Alignment Length:194 Identity:48/195 (25%)
Similarity:68/195 (35%) Gaps:33/195 (17%)


  Fly    36 FLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHYQFNEPQTPIY--WWKLWD-------- 90
            ||::...|....::..|.|.....|..:    ...||...:..|....|  |...||        
  Fly    24 FLVFPRQGSFGLLAAVAIPLELGPKNVY----MAFNFESNYALPSNDSYNQWIDRWDLDDHYLGV 84

  Fly    91 -------GSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQL---GQNGSACLDRLICE 145
                   .:|...|..:|.....|..|.:...|......|..:.:|.|   |.||||||.|.|||
  Fly    85 GGNVTPINARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDFYRSIINFLTHYGFNGSACLLRTICE 149

  Fly   146 --NGQVDEHSGLYAQLLHRLLRPHQTL---DVRYLD----AYRMGRHGVDCRNAFPEAHHCILD 200
              ...:|:.:||...|...|..|..:.   :::::|    |...|.||..|........|..||
  Fly   150 VSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSEYVAHCGHSALD 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 30/100 (30%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48708
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.