DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG7201

DIOPT Version :10

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648200.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:47/121 - (38%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PAPPSVPA---RLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICE-NGQVDEHSGLYAQLLHR 162
            |..|.:||   .:.....::||:...|.:::..|.:|.|||.|.||| :.:..|..|::.::...
  Fly   188 PKYPELPAGLQHIFHGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSLEKFGVFGEMTKL 252

  Fly   163 LL----RPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILDDYLHLHERGPKQSF 214
            .|    .|...|...|:.|..:|.........||....|            ||..|
  Fly   253 FLTVTKSPFSDLVPDYVQAQEVGEGKQAPGECFPYFKDC------------PKSIF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 23/94 (24%)
CG7201NP_648200.1 DM4_12 201..298 CDD:214785 26/108 (24%)

Return to query results.
Submit another query.