DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG7201

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:47/121 - (38%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PAPPSVPA---RLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICE-NGQVDEHSGLYAQLLHR 162
            |..|.:||   .:.....::||:...|.:::..|.:|.|||.|.||| :.:..|..|::.::...
  Fly   188 PKYPELPAGLQHIFHGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSLEKFGVFGEMTKL 252

  Fly   163 LL----RPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILDDYLHLHERGPKQSF 214
            .|    .|...|...|:.|..:|.........||....|            ||..|
  Fly   253 FLTVTKSPFSDLVPDYVQAQEVGEGKQAPGECFPYFKDC------------PKSIF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 23/94 (24%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.