DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG33262

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster

Alignment Length:197 Identity:52/198 (26%)
Similarity:79/198 (40%) Gaps:40/198 (20%)


  Fly     9 LFLFTLEAVSALEANLTSWRHHRRQKRFLIYQNGGVIK--FVSGCAFPAPFMEKKAWRQLVWLMN 71
            |.|..|:.|::.:.       |.|.|||||:......:  |::|...||....:......|....
  Fly    13 LCLIFLQEVASQDV-------HSRSKRFLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAE 70

  Fly    72 FHYQFNEP---QTPIYWWKLWDGSRNLKGPLTQPAPPSVPA---RLLVDEPQLL---LFKFAEAY 127
            ::..:|..   |.|::               .:..|.::.|   |.|..:|..|   |::|.|..
  Fly    71 YYLPYNATVYRQNPLF---------------PEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHM 120

  Fly   128 MNQLGQNGSACLDRLICE--NGQVDEHSGLYAQLLHRLLRPHQTLDV---RYLDAYRMGRHGV-- 185
            :|..|.||.|||...|||  |.:..:......::||.||.|..||:.   |.||.....:.|.  
  Fly   121 LNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRR 185

  Fly   186 DC 187
            ||
  Fly   186 DC 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 29/85 (34%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.