DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13869 and CG33342

Sequence 1:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster

Alignment Length:202 Identity:61/203 (30%)
Similarity:97/203 (48%) Gaps:30/203 (15%)


  Fly     8 ILFLFTLEAVSA---LEANLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVW- 68
            :|.||.|.|.:|   .:.|.:......|.||..|:...|..|.|:|.|||   :::....|.|| 
  Fly    15 VLLLFVLAASAAGDGNDRNASPGLSLSRTKRLAIFNGQGTNKIVAGLAFP---IKQADTVQSVWG 76

  Fly    69 LMNFHYQFNEPQTPIYWWKLWDGSRNL-------KGPLTQPAPPSVPARLLVDEPQLLLFKFAEA 126
            .:|:..|:.....|||||..|:.|..|       ||         :.:|:..||.::.|:...|.
  Fly    77 FVNYQAQYVPSPVPIYWWSFWNTSTFLSTAREWRKG---------IRSRVFQDETRVWLYDVVET 132

  Fly   127 YMNQLG-QNGSACLDRLICENGQVD-EHSGLYAQLLHRLLRPHQTLD---VRYLDAYRMGRHGVD 186
            .:.:|| :|..|||.:.|||..|.. .|:.::.::|:.:|.|  :||   .:||.|...|:.|.:
  Fly   133 GLERLGDRNAGACLLKCICEISQRPFMHNSIFGEILNAVLVP--SLDNVPEKYLHARNAGKAGAN 195

  Fly   187 CRNAFPE 193
            ||..:.:
  Fly   196 CRKTYSD 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 27/86 (31%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746522
eggNOG 1 0.900 E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.