DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP9

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001185260.1 Gene:RLP9 AraportID:AT1G58190 Length:1029 Species:Arabidopsis thaliana

Alignment Length:864 Identity:201/865 (23%)
Similarity:325/865 (38%) Gaps:253/865 (29%)


  Fly   162 EGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLP 226
            |.|.|...|.:::.|..|:.       ||:.:....:|.:                .|.|||:|.
plant    63 ERVECD
RTSGRVIGLFLNQT-------FSDPILINLSLFH----------------PFEELRTLN 104

  Fly   227 ------DAW--------GASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSE 277
                  ..|        ...:|::|:.|.:.:|.::......|...||||.|.:..|::     |
plant   105 LYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNM-----E 164

  Fly   278 AFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLI---RLIVLN 339
            .....|||::                  |..|.:||||||.|      |....||.   :|..|:
plant   165 GTFPMKELKD------------------LSNLELLDLSGNLL------NGPVPGLAVLHKLHALD 205

  Fly   340 LSNN----ALTRIGSKTFKELYFLQILDMRNNSI--------------------GHIEEGAF--- 377
            ||:|    :|.|.|.|:|:.|..|:|||:..|.:                    |:..||.|   
plant   206 LSDNTFSGSLGREGYKSFERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMK 270

  Fly   378 --LPLYNLHTLNLAENR----------LHTL------DNRIFNGLYVLTKLTLNNNLVSIVESQA 424
              :.|.||..|:|::|:          .|.|      ||: |:|        .|..|..:     
plant   271 ELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNK-FSG--------SNKGLCQL----- 321

  Fly   425 FRNCSDLKELDLSSNQLT-EVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRI 488
                .:|:|||||.|:.| :.|:....|:.|:.||:..|..:....:..|||:.:..|.|.||..
plant   322 ----KNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEF 382

  Fly   489 -GNITVGMFQDLPRLSVLNLA--KNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFATLASLL 550
             |..::.:..:|.:|.|..|:  .|.::..:..:.....::..|.|....|.::.........|.
plant   383 KGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLH 447

  Fly   551 WLNLSENHLVW-FDYAFIPS--NLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASH--NRITEIG 610
            .:|||.|.|.. |.|..:..  ||:.|.:..|.:..|.....|...:::..|.|::  .|:.|..
plant   448 VINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSANNFDQRLPENI 512

  Fly   611 AMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFY 675
            ...:|| |..|.::||....|..::|.:...:..:||..|             ..|...|: :|.
plant   513 GKVLPN-IRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHN-------------NFSGSLPM-KFL 562

  Fly   676 LGGNPFECDCSMEWLQRI--NNLTTRQHPHVVDLGNIECLMPHSR-----SAPLRPLASLSASDF 733
            :|       ||.....::  |....:..|...:.|::..|:.::.     :..||.:.||...|.
plant   563 IG-------CSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDL 620

  Fly   734 VCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATW-----------ATNIVDCGRQDLAALP 787
            ...|.....|                          :|           :.|:::      ..||
plant   621 SNNYLQGVIP--------------------------SWFGGFFFAYLFLSNNLLE------GTLP 653

  Fly   788 NRI--PQDVSDLYLDGN----NMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQ--LVNLRV 844
            :.:  ......|.|.||    |:|    .|.|| .::..||||.:..    :|::..  :.::.|
plant   654 STLFSKPTFKILDLSGNKFSGNLP----SHFTG-MD
MSLLYLNDNEF----SGTIPSTLIKDVLV 709

  Fly   845 LHLENNKLTALEGT--EFRSLGLLRELYLHNNMLT-HISNATFEP-----LVSLEVLRLDNNRL- 900
            |.|.||||:   ||  .|.....:..|.|..|.|| ||      |     |.|:.:|.|.|||| 
plant   710 LDLRNNKLS---GTIPHFVKNEFILSLLLRGNTLTGHI------PTDLCGLRSIRILDLANNRLK 765

  Fly   901 SSLPHLQYRHSLQGLTLGR 919
            .|:|     ..|..::.||
plant   766 GSIP-----TCLNNVSFGR 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 6/19 (32%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 3/8 (38%)
leucine-rich repeat 171..201 CDD:275380 5/30 (17%)
LRR_RI 210..464 CDD:238064 81/317 (26%)
leucine-rich repeat 212..236 CDD:275380 7/38 (18%)
LRR_8 235..295 CDD:290566 14/60 (23%)
leucine-rich repeat 237..260 CDD:275380 5/23 (22%)
leucine-rich repeat 261..284 CDD:275380 6/23 (26%)
LRR_8 283..345 CDD:290566 20/69 (29%)
leucine-rich repeat 285..308 CDD:275380 2/23 (9%)
leucine-rich repeat 309..334 CDD:275380 11/28 (39%)
LRR_8 334..393 CDD:290566 26/98 (27%)
leucine-rich repeat 335..358 CDD:275380 11/27 (41%)
leucine-rich repeat 359..382 CDD:275380 10/48 (21%)
LRR_8 382..441 CDD:290566 20/75 (27%)
leucine-rich repeat 383..406 CDD:275380 10/39 (26%)
leucine-rich repeat 407..430 CDD:275380 2/23 (9%)
LRR_8 431..488 CDD:290566 21/58 (36%)
leucine-rich repeat 431..451 CDD:275380 9/21 (43%)
leucine-rich repeat 454..477 CDD:275380 7/23 (30%)
LRR_8 477..559 CDD:290566 18/85 (21%)
leucine-rich repeat 478..499 CDD:275380 5/22 (23%)
leucine-rich repeat 502..525 CDD:275380 4/25 (16%)
leucine-rich repeat 526..548 CDD:275380 3/22 (14%)
leucine-rich repeat 590..617 CDD:275380 7/29 (24%)
leucine-rich repeat 618..641 CDD:275380 6/23 (26%)
leucine-rich repeat 642..689 CDD:275380 9/47 (19%)
LRRCT 679..736 CDD:214507 11/64 (17%)
leucine-rich repeat 775..796 CDD:275380 2/23 (9%)
LRR_8 797..852 CDD:290566 20/61 (33%)
leucine-rich repeat 797..817 CDD:275380 9/24 (38%)
leucine-rich repeat 818..841 CDD:275380 5/25 (20%)
LRR_8 841..900 CDD:290566 25/67 (37%)
leucine-rich repeat 842..865 CDD:275380 10/25 (40%)
LRR_4 866..907 CDD:289563 18/48 (38%)
leucine-rich repeat 866..889 CDD:275380 9/29 (31%)
leucine-rich repeat 890..911 CDD:275380 8/22 (36%)
TIR 1045..1183 CDD:214587
RLP9NP_001185260.1 LRRNT_2 32..68 CDD:285463 3/5 (60%)
LRR_RI <92..240 CDD:238064 50/193 (26%)
LRR <120..>333 CDD:227223 68/260 (26%)
leucine-rich repeat 129..152 CDD:275380 5/23 (22%)
leucine-rich repeat 153..177 CDD:275380 9/47 (19%)
LRR_RI 170..383 CDD:238064 70/255 (27%)
leucine-rich repeat 178..200 CDD:275380 11/28 (39%)
leucine-rich repeat 201..228 CDD:275380 11/27 (41%)
leucine-rich repeat 229..277 CDD:275380 10/48 (21%)
leucine-rich repeat 278..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..323 CDD:275380 7/40 (18%)
LRR_8 322..380 CDD:290566 20/58 (34%)
leucine-rich repeat 324..347 CDD:275380 10/23 (43%)
leucine-rich repeat 348..371 CDD:275380 7/23 (30%)
leucine-rich repeat 372..396 CDD:275380 6/24 (25%)
LRR_RI 422..673 CDD:238064 57/305 (19%)
LRR_8 422..481 CDD:290566 15/59 (25%)
leucine-rich repeat 423..445 CDD:275380 3/22 (14%)
leucine-rich repeat 446..470 CDD:275380 8/24 (33%)
leucine-rich repeat 471..493 CDD:275380 5/22 (23%)
LRR_8 493..553 CDD:290566 15/74 (20%)
leucine-rich repeat 494..518 CDD:275380 5/24 (21%)
leucine-rich repeat 519..542 CDD:275380 6/23 (26%)
leucine-rich repeat 543..567 CDD:275380 9/45 (20%)
leucine-rich repeat 568..591 CDD:275380 3/23 (13%)
leucine-rich repeat 592..614 CDD:275380 3/22 (14%)
leucine-rich repeat 615..637 CDD:275380 5/48 (10%)
leucine-rich repeat 638..661 CDD:275380 3/29 (10%)
leucine-rich repeat 662..684 CDD:275380 9/27 (33%)
leucine-rich repeat 685..707 CDD:275380 5/26 (19%)
leucine-rich repeat 730..753 CDD:275380 9/29 (31%)
leucine-rich repeat 754..780 CDD:275380 11/32 (34%)
leucine-rich repeat 781..867 CDD:275380
LRR_8 847..902 CDD:290566
leucine-rich repeat 868..891 CDD:275380
leucine-rich repeat 892..912 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.